BitterDB

hTAS2R14 - Taste receptor type 2 member 14 help

Properties help

  • Human
  • chr12:11,090,854-11,091,806 UCSC
  • 124
  • 36,160 (Da)


  • MGGVIKSIFTFVLIVEFIIGNLGNSFIALVNCIDWVKGRK ISSVDRILTALAISRISLVW LIFGSWCVSVFFPALFATE KMFRMLTNIWTVINHFSVWLATGLGTFYFLKIANFSNSIF L YLKWRVKKVVLVLLLVTSVFLFLNIALINIHINASING YRRNKTCSSDSSNFTRFSSLIV LTSTVFIFIPFTLSLAM FLLLIFSMWKHRKKMQHTVKISGDASTKAHRGVKSVITFF LLY AIFSLSFFISVWTSERLEENLIILSQVMGMAYPSCH SCVLILGNKKLRQASLSVLLWLRY MFKDGEPSGHKEFRE SS

Known Ligands help

Please scroll down to see the rest of the ligands.

Download SDF file of selected compounds.

Protein Diagram help

Receptor snake diagram

When using this 2D protein diagram,please cite us:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper: BitterDB paper

Known Mutations Table help

No mutations were reported yet.

Links:

Q9NYV8
TAS2R14