BitterDB

hTAS2R14 - Taste receptor type 2 member 14 help

Properties help

  • Human
  • chr12:11,090,854-11,091,806 UCSC
  • 151
  • 36,160 (Da)


  • MGGVIKSIFTFVLIVEFIIGNLGNSFIALVNCIDWVKGRK ISSVDRILTALAISRISLVW LIFGSWCVSVFFPALFATE KMFRMLTNIWTVINHFSVWLATGLGTFYFLKIANFSNSIF L YLKWRVKKVVLVLLLVTSVFLFLNIALINIHINASING YRRNKTCSSDSSNFTRFSSLIV LTSTVFIFIPFTLSLAM FLLLIFSMWKHRKKMQHTVKISGDASTKAHRGVKSVITFF LLY AIFSLSFFISVWTSERLEENLIILSQVMGMAYPSCH SCVLILGNKKLRQASLSVLLWLRY MFKDGEPSGHKEFRE SS

Known Ligands help

Please scroll down to see the rest of the ligands.

Download SDF file of selected compounds.

3D Homology Model help

Click here to download the model PDB file.

When using this 3D model, please cite us:
Promiscuity and selectivity of bitter molecules and their receptors. Bioorg Med Chem 23 (2015) 4082-4091.
doi: 10.1016/j.bmc.2015.04.025

Protein Diagram help

Receptor snake diagram

When using this 2D protein diagram,please cite us:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper: BitterDB paper

SNPs Table help

No SNPs were reported yet.

Known Mutations Table help

ReceptorLocationBW numberResidueReferences
T2R14TM22.61W66doi: 10.1016/j.bbagen.2018.07.009
T2R14ECL13.28L85doi: 10.1016/j.bbagen.2018.07.009
T2R14ECL13.29T86doi: 10.1016/j.bbagen.2018.07.009
T2R14ECL13.3N87doi: 10.1016/j.bbagen.2018.07.009
T2R14TM33.32W89doi: 10.1016/j.bbagen.2018.07.009
T2R14TM33.33T90doi: 10.1016/j.bbagen.2018.07.009
T2R14TM33.36N93doi: 10.1016/j.bbagen.2018.07.009
T2R14TM33.37H94doi: 10.1016/j.bbagen.2018.07.009
T2R14ECL25.42T182doi: 10.1016/j.bbagen.2018.07.009
T2R14ECL25.43S183doi: 10.1016/j.bbagen.2018.07.009
T2R14TM55.46F186doi: 10.1016/j.bbagen.2018.07.009
T2R14TM55.47I187doi: 10.1016/j.bbagen.2018.07.009
T2R14TM66.48Y240doi: 10.1016/j.bbagen.2018.07.009
T2R14TM66.49A241doi: 10.1016/j.bbagen.2018.07.009
T2R14TM66.51F243doi: 10.1016/j.bbagen.2018.07.009
T2R14TM66.55F247doi: 10.1016/j.bbagen.2018.07.009
T2R14TM77.36I263doi: 10.1016/j.bbagen.2018.07.009
T2R14TM77.39Q266doi: 10.1016/j.bbagen.2018.07.009
T2R14TM77.42G269doi: 10.1016/j.bbagen.2018.07.009

Links and Citations:

Q9NYV8
t2r14_human
TAS2R14
ENSG00000212127-TAS2R14

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402