BitterDB

hTAS2R10 - Taste receptor type 2 member 10 help

Properties help

  • Human
  • chr12:10,977,945-10,978,868 UCSC
  • 45
  • 35,395 (Da)


  • MLRVVEGIFIFVVVSESVFGVLGNGFIGLVNCIDCAKNKL STIGFILTGLAISRIFLIWIIITDGFIQIFSPNIYASGNL IEYISYFWVIGNQSSMWFATSLSIFYFLKIANFSNYIFLW LKSRTNMVLPFMIVFLLISSLLNFAYIAKILNDYKMKNDT VWDLNMYKSEYFIKQILLNLGVIFFFTLSLITCIFLIISL WRHNRQMQSNVTGLRDSNTEAHVKAMKVLISFIILFILYF IGMAIEISCFTVRENKLLLMFGMTTTAIYPWGHSFILILG NSKLKQASLRVLQQLKCCEKRKNLRVT

Known Ligands help

3D Homology Model help

Click here to download the model PDB file.

When using this 3D model, please cite us:
Promiscuity and selectivity of bitter molecules and their receptors. Bioorg Med Chem 23 (2015) 4082-4091.
doi: 10.1016/j.bmc.2015.04.025

Protein Diagram help

Receptor snake diagram

When using this 2D protein diagram,please cite us:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper: BitterDB paper

SNPs Table help

ReceptorLocationBW numberResidueMAFdbSNP
TAS2R10EC2 T156M0.0571rs597468

Known Mutations Table help

ReceptorLocationBW numberResidueReferences
TAS2R10TM33.29S85doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1523/JNEUROSCI.3248-12.2013 doi: 10.3389/fmolb.2017.00063
TAS2R10TM33.32W88doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1523/JNEUROSCI.3248-12.2013 doi: 10.3389/fmolb.2017.00063
TAS2R10TM33.33V89doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1523/JNEUROSCI.3248-12.2013 doi: 10.3389/fmolb.2017.00063
TAS2R10TM33.36N92doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1523/JNEUROSCI.3248-12.2013 doi: 10.3389/fmolb.2017.00063
TAS2R10TM33.37Q93doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1073/pnas.0913862107 doi: 10.1523/JNEUROSCI.3248-12.2013 doi: 10.3389/fmolb.2017.00063
TAS2R10TM55.4Q175doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1523/JNEUROSCI.3248-12.2013 doi: 10.3389/fmolb.2017.00063
TAS2R10TM55.43L178doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1523/JNEUROSCI.3248-12.2013 doi: 10.3389/fmolb.2017.00063
TAS2R10TM66.51Y239doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1523/JNEUROSCI.3248-12.2013 doi: 10.3389/fmolb.2017.00063
TAS2R10TM77.39M263doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.3389/fmolb.2017.00063 doi: 10.1523/JNEUROSCI.3248-12.2013 doi: 10.3389/fmolb.2017.00063
TAS2R10TM77.42T266doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.3389/fmolb.2017.00063 doi: 10.1523/JNEUROSCI.3248-12.2013 doi: 10.3389/fmolb.2017.00063

Links and Citations:

Q9NYW0
t2r10_human
TAS2R10
ENSG00000121318-TAS2R10

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402