BitterDB

hTAS2R46 - Taste receptor type 2 member 46 help

hTAS2R46 is a bitter receptor broadly tuned to sesquiterpene lactones, related clerodane diterpenoids,labdane diterpenes and more.

Properties help

  • Human
  • chr12:11,213,964-11,214,893 UCSC
  • 68
  • 35,523 (Da)


  • MITFLPIIFSILIVVTFVIGNFANGFIALVNSIEWFKRQK ISFADQILTALAVSRVGLLWVLVLNWYATELNPAFNSIEV RITAYNVWAVINHFSNWLATSLSIFYLLKIANFSNLIFLH LKRRVKSVVLVILLGPLLFLVCHLFVINMNQIIWTKEYEG NMTWKIKLRSAMYLSNTTVTILANLVPFTLTLISFLLLIC SLCKHLKKMQLHGKGSQDPSMKVHIKALQTVTSFLLLCAI YFLSIIMSVWSFESLENKPVFMFCEAIAFSYPSTHPFILI WGNKKLKQTFLSVLWHVRYWVKGEKPSSS

Known Ligands help

3D Homology Model help

Click here to download the model PDB file.

When using this 3D model, please cite us:
Promiscuity and selectivity of bitter molecules and their receptors. Bioorg Med Chem 23 (2015) 4082-4091.
doi: 10.1016/j.bmc.2015.04.025

Protein Diagram help

Receptor snake diagram

When using this 2D protein diagram,please cite us:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper: BitterDB paper

SNPs Table help

ReceptorLocationBW numberResidueMAFdbSNP
TAS2R46IC3 L228M0.3359rs2708380

Known Mutations Table help

ReceptorLocationBW numberResidueReferences
TAS2R46TM22.6N65doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005
TAS2R46TM22.61W66doi: 10.1021/acs.jctc.5b00472 doi: 10.1073/pnas.0913862107 doi: 10.1016/bs.mcb.2015.10.005
TAS2R46TM22.64T69doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005
TAS2R46TM22.65E70doi: 10.1021/acs.jctc.5b00472 doi: 10.1073/pnas.0913862107 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.3389/fmolb.2017.00063
TAS2R46EC12.66L71doi: 10.3389/fmolb.2017.00063 doi: 10.1016/j.jsamd.2017.03.001
TAS2R46TM33.26I82doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.3389/fmolb.2017.00063
TAS2R46TM33.29Y85doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005
TAS2R46TM33.3N86doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005
TAS2R46TM33.32W88doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005
TAS2R46TM33.33A89doi: 10.1021/acs.jctc.5b00472 doi: 10.1073/pnas.0913862107 doi: 10.1016/bs.mcb.2015.10.005
TAS2R46TM33.36N92doi: 10.1021/acs.jctc.5b00472 doi: 10.1073/pnas.0913862107 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1371/journal.pone.0064675 doi: 10.3389/fmolb.2017.00063 doi: 10.1016/j.jsamd.2017.03.001
TAS2R46TM33.37H93doi: 10.1021/acs.jctc.5b00472 doi: 10.1073/pnas.0913862107 doi: 10.1016/bs.mcb.2015.10.005
TAS2R46TM33.4N96doi: 10.1021/acs.jctc.5b00472 doi: 10.1073/pnas.0913862107 doi: 10.1016/bs.mcb.2015.10.005
TAS2R46TM44.6I147doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005
TAS2R46EC24.65N150doi: 10.3389/fmolb.2017.00063
TAS2R46EC24.76N161doi: 10.3389/fmolb.2017.00063
TAS2R46TM55.38S175doi: 10.1021/acs.jctc.5b00472
TAS2R46TM55.39N176doi: 10.1021/acs.jctc.5b00472 doi: 10.1073/pnas.0913862107 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.3389/fmolb.2017.00063 doi: 10.1016/j.jsamd.2017.03.001
TAS2R46TM55.43T180doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005
TAS2R46TM55.47N184doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005
TAS2R46TM66.51Y241doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.3389/fmolb.2017.00063 doi: 10.1016/j.jsamd.2017.03.001
TAS2R46TM66.52F242doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1371/journal.pone.0064675
TAS2R46TM66.54S244doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005
TAS2R46TM66.55I245doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005
TAS2R46TM66.58S248doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005
TAS2R46TM66.59V249doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005
TAS2R46EC36.62E253doi: 10.3389/fmolb.2017.00063
TAS2R46TM77.35E261doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.3389/fmolb.2017.00063
TAS2R46TM77.39E265doi: 10.1021/acs.jctc.5b00472 doi: 10.1073/pnas.0913862107 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.3389/fmolb.2017.00063
TAS2R46TM77.42A268doi: 10.1021/acs.jctc.5b00472 doi: 10.1073/pnas.0913862107 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.3389/fmolb.2017.00063
TAS2R46TM77.43F269doi: 10.1021/acs.jctc.5b00472 doi: 10.1073/pnas.0913862107 doi: 10.3389/fmolb.2017.00063

Links and Citations:

P59540
t2r46_human
TAS2R46
ENSG00000226761-TAS2R46

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402