BitterDB

hTAS2R4 - Taste receptor type 2 member 4 help

Properties help

  • Human
  • chr7:141,478,289-141,479,188 UCSC
  • 33
  • 33,841 (Da)


  • MLRLFYFSAIIASVILNFVGIIMNLFITVVNCKTWVKSHR ISSSDRILFSLGITRFLMLGLFLVNTIYFVSSNTERSVYL SAFFVLCFMFLDSSSVWFVTLLNILYCVKITNFQHSVFLL LKRNISPKIPRLLLACVLISAFTTCLYITLSQASPFPELV TTRNNTSFNISEGILSLVVSLVLSSSLQFIINVTSASLLI HSLRRHIQKMQKNATGFWNPQTEAHVGAMKLMVYFLILYI PYSVATLVQYLPFYAGMDMGTKSICLIFATLYSPGHSVLI IITHPKLKTTAKKILCFKK

Known Ligands help

3D Homology Model help

Click here to download the model PDB file.

When using this 3D model, please cite us:
Promiscuity and selectivity of bitter molecules and their receptors. Bioorg Med Chem 23 (2015) 4082-4091.
doi: 10.1016/j.bmc.2015.04.025

Protein Diagram help

Receptor snake diagram

When using this 2D protein diagram,please cite us:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper: BitterDB paper

SNPs Table help

ReceptorLocationBW numberResidueMAFdbSNP
TAS2R41.33F7S0.4305rs2233998
TAS2R43.4V96L0.4734rs2234001
TAS2R4EC2 S171N0.4914rs2234002

Known Mutations Table help

ReceptorLocationBW numberResidueReferences
TAS2R4TM11.46G28doi: 10.1021/acs.jctc.5b00472 doi: 10.1111/j.1471-4159.2012.07808.x
TAS2R4TM33.26A90doi: 10.3389/fmolb.2017.00063
TAS2R4TM33.27F91doi: 10.3389/fmolb.2017.00063
TAS2R4TM33.28F92doi: 10.3389/fmolb.2017.00063
TAS2R4TM44.61Y155doi: 10.3389/fmolb.2017.00063
TAS2R4EC25.35N173doi: 10.3389/fmolb.2017.00063
TAS2R4EC25.36T174doi: 10.3389/fmolb.2017.00063
TAS2R4TM55.53I191doi: 10.1016/j.bbamem.2013.08.009
TAS2R4IC36.24G216doi: 10.1016/j.bbamem.2013.08.009
TAS2R4IC36.42Y234doi: 10.1016/j.bbamem.2013.08.009
TAS2R4IC36.45I237doi: 10.1016/j.bbamem.2013.08.009
TAS2R4TM66.59Y258doi: 10.3389/fmolb.2017.00063
TAS2R4TM77.35K270doi: 10.3389/fmolb.2017.00063
TAS2R4TM77.47P274doi: 10.1016/j.bbamem.2013.08.009
TAS2R4TM77.47S285doi: 10.1021/acs.jctc.5b00472 doi: 10.1111/j.1471-4159.2012.07808.x

Links and Citations:

Q9NYW5
ta2r4_human
TAS2R4
ENSG00000127364-TAS2R4

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402