BitterDB

hTAS2R1 - Taste receptor type 2 member 1 help

Properties help

  • Human
  • chr5:9,629,109-9,630,463 UCSC
  • 39
  • 34,333 (Da)


  • MLESHLIIYFLLAVIQFLLGIFTNGIIVVVNGIDLIKHRK MAPLDLLLSCLAVSRIFLQLFIFYVNVIVIFFIEFIMCSA NCAILLFINELELWLATWLGVFYCAKVASVRHPLFIWLKM RISKLVPWMILGSLLYVSMICVFHSKYAGFMVPYFLRKFF SQNATIQKEDTLAIQIFSFVAEFSVPLLIFLFAVLLLIFS LGRHTRQMRNTVAGSRVPGRGAPISALLSILSFLILYFSH CMIKVFLSSLKFHIRRFIFLFFILVIGIYPSGHSLILILG NPKLKQNAKKFLLHSKCCQ

Known Ligands help

3D Homology Model help

Click here to download the model PDB file.

When using this 3D model, please cite us:
Promiscuity and selectivity of bitter molecules and their receptors. Bioorg Med Chem 23 (2015) 4082-4091.
doi: 10.1016/j.bmc.2015.04.025

Protein Diagram help

Receptor snake diagram

When using this 2D protein diagram,please cite us:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper: BitterDB paper

SNPs Table help

ReceptorLocationBW numberResidueMAFdbSNP
TAS2R1IC2R111H0.1436rs41469
TAS2R1IC3R206W0.1142rs2234233

Known Mutations Table help

ReceptorLocationBW numberResidueReferences
TAS2R1TM11.5N24doi: 10.1021/acs.jctc.5b00472 doi: 10.1074/jbc.M111.246983
TAS2R1TM11.53I27doi: 10.1021/acs.jctc.5b00472 doi: 10.1074/jbc.M111.246983
TAS2R1TM22.5R55doi: 10.1021/acs.jctc.5b00472 doi: 10.1074/jbc.M111.246983
TAS2R1TM22.56F61doi: 10.1074/jbc.M111.246983
TAS2R1TM22.61N66doi: 10.3389/fmolb.2017.00063 doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1074/jbc.M111.246983
TAS2R1EC1E74doi: 10.3389/fmolb.2017.00063
TAS2R1TM33.32L85doi: 10.1016/bs.mcb.2015.10.005 doi: 10.3109/10799893.2011.578141
TAS2R1TM33.33L86doi: 10.1016/bs.mcb.2015.10.005 doi: 10.3109/10799893.2011.578141
TAS2R1TM33.36N89doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1074/jbc.M111.246983 doi: doi: 10.1021/acs.jctc.5b00472 doi: 10.1074/jbc.M111.246983
TAS2R1TM33.37E90doi: 10.1016/bs.mcb.2015.10.005 doi: 10.3109/10799893.2011.578141
TAS2R1TM33.41W94doi: 10.1021/acs.jctc.5b00472 doi: 10.1074/jbc.M111.246983
TAS2R1TM33.46L99doi: 10.1021/acs.jctc.5b00472 doi: 10.1074/jbc.M111.246983
TAS2R1TM55.46E182doi: 10.1016/bs.mcb.2015.10.005 doi: 10.3109/10799893.2011.578141
TAS2R1TM55.61L197doi: 10.1021/acs.jctc.5b00472 doi: 10.1074/jbc.M111.246983
TAS2R1TM55.64S200doi: 10.1021/acs.jctc.5b00472 doi: 10.1074/jbc.M111.246983
TAS2R1TM55.65L201doi: 10.1021/acs.jctc.5b00472 doi: 10.1074/jbc.M111.246983
TAS2R1TM77.39I263doi: 10.1016/bs.mcb.2015.10.005 doi: 10.3109/10799893.2011.578141
TAS2R1TM77.49H273doi: 10.1021/acs.jctc.5b00472 doi: 10.1074/jbc.M111.246983
TAS2R1TM77.53L277doi: 10.1021/acs.jctc.5b00472 doi: 10.1074/jbc.M111.246983
TAS2R1TM77.54I278doi: 10.1021/acs.jctc.5b00472 doi: 10.1074/jbc.M111.246983

Links and Citations:

Q9NYW7
ta2r1_human
TAS2R1
ENSG00000169777-TAS2R1

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402