BitterDB

hTAS2R47 - Taste receptor type 2 member 47 help

Properties help

  • Human
  • chr12:11,285,884-11,286,843 UCSC
  • 10
  • 36,792 (Da)


  • MITFLPIIFSILIVVIFVIGNFANGFIALVNSIEWVKRQK ISFVDQILTALAVSRVGLLWVLLLHWYATQLNPAFYSVEV RITAYNVWAVTNHFSSWLATSLSMFYLLRIANFSNLIFLR IKRRVKSVVLVILLGPLLFLVCHLFVINMDETVWTKEYEG NVTWKIKLRSAMYHSNMTLTMLANFVPLTLTLISFLLLIC SLCKHLKKMQLHGKGSQDPSTKVHIKALQTVTSFLLLCAI YFLSMIISVCNLGRLEKQPVFMFCQAIIFSYPSTHPFILI LGNKKLKQIFLSVLRHVRYWVKDRSLRLHRFTRAALCKG

Known Ligands help

Please scroll down to see the rest of the ligands.

Download SDF file of selected compounds.

3D Homology Model help

Click here to download the model PDB file.

When using this 3D model, please cite us:
Promiscuity and selectivity of bitter molecules and their receptors. Bioorg Med Chem 23 (2015) 4082-4091.
doi: 10.1016/j.bmc.2015.04.025

Protein Diagram help

Receptor snake diagram

When using this 2D protein diagram,please cite us:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper: BitterDB paper

SNPs Table help

ReceptorLocationBW numberResidueMAFdbSNP
TAS2R474.43K126Q0.0615rs12424373
TAS2R47EC3 F252L0.3512rs2599404

Known Mutations Table help

ReceptorLocationBW numberResidueReferences
TAS2R47TM33.32W88doi: 10.3389/fmolb.2017.00063 doi: 10.1021/acs.jctc.5b00472 doi: 10.1073/pnas.0913862107 doi: 10.1016/bs.mcb.2015.10.005 doi:
TAS2R47TM33.36N92doi: 10.3389/fmolb.2017.00063 doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi:

Links and Citations:

P59541
t2r30_human
TAS2R30
ENSG00000256188-TAS2R30

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402