BitterDB

hTAS2R47 - Taste receptor type 2 member 47 help

Properties help

  • Human
  • chr12:11,285,884-11,286,843 UCSC
  • 10
  • 36,792 (Da)


  • MITFLPIIFSILIVVIFVIGNFANGFIALVNSIEWVKRQK ISFVDQILTALAVSRVGLLWVLLLHWYATQLNPAFYSVEV RITAYNVWAVTNHFSSWLATSLSMFYLLRIANFSNLIFLR IKRRVKSVVLVILLGPLLFLVCHLFVINMDETVWTKEYEG NVTWKIKLRSAMYHSNMTLTMLANFVPLTLTLISFLLLIC SLCKHLKKMQLHGKGSQDPSTKVHIKALQTVTSFLLLCAI YFLSMIISVCNLGRLEKQPVFMFCQAIIFSYPSTHPFILI LGNKKLKQIFLSVLRHVRYWVKDRSLRLHRFTRAALCKG

Known Ligands help

Please scroll down to see the rest of the ligands.

Protein Diagram help

Receptor snake diagram

When using this 2D protein diagram,please cite us:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper: BitterDB paper

Known Mutations Table help

Residue Location Ballesteros Weinstein: Mutation Experimental data References
W88 TM3 3.32 W88A Completely abolished activation by denatonium [1]
W88F
N92 TM3 3.36 N92G Completely abolished activation by denatonium [1]
N92A
N92D Mutant retained 16% of the WT activity [1]
EL3 swap (C250–V260) EL3 swap with hT2RS43 EL3. 6 mutations. No apparent effect on receptor activity [1]

[1] Pronin, A. N., et al. (2004) Identification of Ligands for Two Human Bitter T2R Receptors, Chemical Senses 29, 583-593.

Links:

P59541
TAS2R30