BitterDB

hTAS2R43 - Taste receptor type 2 member 43 help

The closest relative of t2r43 is hT2R30 (44), which is 89% identical

Properties help

  • Human
  • chr12:11,243,886-11,244,912 UCSC
  • 16
  • 35,519 (Da)


  • MITFLPIIFSSLVVVTFVIGNFANGFIALVNSIESFKRQK ISFADQILTALAVSRVGLLWVLLLNWYSTVLNPAFNSVEV RTTAYNIWAVINHFSNWLATTLSIFYLLKIANFSNFIFLH LKRRVKSVILVMLLGPLLFLACHLFVINMNEIVRTKEFEG NMTWKIKLKSAMYFSNMTVTMVANLVPFTLTLLSFMLLIC SLCKHLKKMQLRGKGSQDPSTKVHIKALQTVISFLLLCAI YFLSIMISVWSFGSLENKPVFMFCKAIRFSYPSIHPFILI WGNKKLKQTFLSVFWQMRYWVKGEKTSSP

Known Ligands help

Please scroll down to see the rest of the ligands.

Protein Diagram help

Receptor snake diagram

When using this 2D protein diagram,please cite us:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper: BitterDB paper

Known Mutations Table help

Residue Location Ballesteros-Weinstein: Mutation Experimental data References
N76 EL1 2.71 N76Y Had very little effect on activation by 6-nitrosaccharin or IMNB. [3] [3]
I87 TM3 3.31 I87V Had very little effect on activation by 6-nitrosaccharin or IMNB. [3]
W88 EL1 3.32 W88F No effect on activation by 6-nitrosaccharin. [3]
W88A Completely abolished receptor activation by 6-nitrosaccharin.
I91 TM3 3.35 I91T Had very little effect on activation by 6-nitrosaccharin or IMNB. [3]
N92 TM3 3.36 N92G Reduced activation by 6-nitrosaccharin and IMNB [3]
N92A Mild reduction in activation by IMNB and 6- nitrosaccharin
N92D Completely eliminated receptor responsiveness to both IMNB and 6- nitrosaccharin. Had a dramatic increasing effect on basal activity.
N92W Almost eliminated receptor responsiveness to both IMNB and 6- nitrosaccharin.
N92K Completely eliminated receptor responsiveness to both IMNB and 6- nitrosaccharin.
K265, R268 TM7 7.39, 7.42 K265E ⁄ R268A Double Mutant Abolished antagonist activity. [1]
V70, T82, G253, K265, R268 V70E, T82I, G253E, K265E, R268A Switching of receptor ligand specificities [2]
EL1 swap EL1 Sswap with hT2RS44 EL1 N76Y/I87V/I91T/N92G. 4 Mutations Receptor insensitive to IMNB. [3]
EL2 swap EL2 Swap with hT2RS44 EL2, 11 Mutations. No effect on IMNB-mediated receptor activation. [3]
EL1 + EL2 swap EL1 + EL2 swap with hT2RS44 EL1+EL2. Eliminates most of the activation by 6-nitrosaccharin. [3]
EL3 swap (W250 – V260) EL3 swap with hT2RS47 EL3. 6 mutations. No apparent effect on receptor activity [3]

[1] Slack, J. P., et al. (2010) Modulation of bitter taste perception by a small molecule hTAS2R antagonist, Curr Biol 20, 1104-1109.

[2] Brockhoff, A., et al. (2010) Structural requirements of bitter taste receptor activation, Proc Natl Acad Sci U S A 107 , 11110-11115.

[3] Pronin, A. N., et al. (2004) Identification of Ligands for Two Human Bitter T2R Receptors, Chemical Senses 29, 583-593.

  • See also mutation data for hTAS2R31 (44) which is 88% identical to hTAS2R43.

  • For more information about Structural requirements hTAS2R43 activation and hTAS2R43 Antagonist Binding refer to hTAS2R46 .

Links:

P59537
TAS2R43