BitterDB

hTAS2R43 - Taste receptor type 2 member 43 help

The closest relative of t2r43 is hT2R30 (44), which is 89% identical

Properties help

  • Human
  • chr12:11,243,886-11,244,912 UCSC
  • 19
  • 35,519 (Da)


  • MITFLPIIFSSLVVVTFVIGNFANGFIALVNSIESFKRQK ISFADQILTALAVSRVGLLWVLLLNWYSTVLNPAFNSVEV RTTAYNIWAVINHFSNWLATTLSIFYLLKIANFSNFIFLH LKRRVKSVILVMLLGPLLFLACHLFVINMNEIVRTKEFEG NMTWKIKLKSAMYFSNMTVTMVANLVPFTLTLLSFMLLIC SLCKHLKKMQLRGKGSQDPSTKVHIKALQTVISFLLLCAI YFLSIMISVWSFGSLENKPVFMFCKAIRFSYPSIHPFILI WGNKKLKQTFLSVFWQMRYWVKGEKTSSP

Known Ligands help

3D Homology Model help

Click here to download the model PDB file.

When using this 3D model, please cite us:
Promiscuity and selectivity of bitter molecules and their receptors. Bioorg Med Chem 23 (2015) 4082-4091.
doi: 10.1016/j.bmc.2015.04.025

Protein Diagram help

Receptor snake diagram

When using this 2D protein diagram,please cite us:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper: BitterDB paper

SNPs Table help

ReceptorLocationBW numberResidueMAFdbSNP
TAS2R43IC1W35S0.3784rs68157013
TAS2R43IC3H212R0.3782rs71443637

Known Mutations Table help

Links and Citations:

P59537
t2r43_human
TAS2R43
ENSG00000255374-TAS2R43

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402