BitterDB

hTAS2R40 - Taste receptor type 2 member 40 help

Properties help

  • Human
  • chr7:142,919,172-142,920,142 UCSC
  • 11
  • 36,812 (Da)


  • MATVNTDATDKDISKFKVTFTLVVSGIECITGILGSGFIT AIYGAEWARGKTLPTGDRIMLMLSFSRLLLQIWMMLENIF SLLFRIVYNQNSVYILFKVITVFLNHSNLWFAAWLKVFYC LRIANFNHPLFFLMKRKIIVLMPWLLRLSVLVSLSFSFPL SRDVFNVYVNSSIPIPSSNSTEKKYFSETNMVNLVFFYNM GIFVPLIMFILAATLLILSLKRHTLHMGSNATGSRDPSMK AHIGAIKATSYFLILYIFNAIALFLSTSNIFDTYSSWNIL CKIIMAAYPAGHSVQLILGNPGLRRAWKRFQHQVPLYLKG QTL

Known Ligands help

Please scroll down to see the rest of the ligands.

Protein Diagram help

Receptor snake diagram

When using this 2D protein diagram,please cite us:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper: BitterDB paper

Known Mutations Table help

No mutations were reported yet.

Links:

P59535
TAS2R40