BitterDB

hTAS2R41 - Taste receptor type 2 member 41 help

Properties help

  • Human
  • chr7:143,174,966-143,175,889 UCSC
  • 2
  • 35,896 (Da)


  • MQAALTAFFVLLFSLLSLLGIAANGFIVLVLGREWLRYGR LLPLDMILISLGASRFCLQL VGTVHNFYYSAQKVEYSG GLGRQFFHLHWHFLNSATFWFCSWLSVLFCVKIANITHST FL WLKWRFPGWVPWLLLGSVLISFIITLLFFWVNYPVY QEFLIRKFSGNMTYKWNTRIETYY FPSLKLVIWSIPFS VFLVSIMLLINSLRRHTQRMQHNGHSLQDPSTQAHTRALK SLISFL ILYALSFLSLIIDAAKFISMQNDFYWPWQIAV YLCISVHPFILIFSNLKLRSVFSQLLLL ARGFWVA

Known Ligands help

Download SDF file of selected compounds.

3D Homology Model help

Click here to download the model PDB file.

When using this 3D model, please cite us:
Promiscuity and selectivity of bitter molecules and their receptors. Bioorg Med Chem 23 (2015) 4082-4091.
doi: 10.1016/j.bmc.2015.04.025

Protein Diagram help

Receptor snake diagram

When using this 2D protein diagram,please cite us:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper: BitterDB paper

SNPs Table help

ReceptorLocationBW numberResidueMAFdbSNP
TAS2R41IC2 P127L0.2113rs10278721

Known Mutations Table help

No mutations were reported yet.

Links and Citations:

P59536
t2r41_human
TAS2R41
ENSG00000221855-TAS2R41

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402