BitterDB

hTAS2R44- Taste receptor type 2 member 44 help

Properties help

  • Human
  • chr12:11,182,986-11,184,006 UCSC
  • 8
  • 35,296 (Da)


  • MTTFIPIIFSSVVVVLFVIGNFANGFIALVNSIERVKRQK ISFADQILTALAVSRVGLLWVLLLNWYSTVFNPAFYSVEV RTTAYNVWAVTGHFSNWLATSLSIFYLLKIANFSNLIFLH LKRRVKSVILVMLLGPLLFLACQLFVINMKEIVRTKEYEG NMTWKIKLRSAVYLSDATVTTLGNLVPFTLTLLCFLLLIC SLCKHLKKMQLHGKGSQDPSTKVHIKALQTVIFFLLLCAV YFLSIMISVWSFGSLENKPVFMFCKAIRFSYPSIHPFILI WGNKKLKQTFLSVLRQVRYWVKGEKPSSP

Known Ligands help

Please scroll down to see the rest of the ligands.

Protein Diagram help

Receptor snake diagram

When using this 2D protein diagram,please cite us:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper: BitterDB paper

Known Mutations Table help

Residue Location Ballesteros-Weinstein: Mutation Experimental data References
Y76 EL1 Y76N Very minor effect on activation by 6-nitrosaccharin or IMNB. [2]
V87 TM3 3.31 V87I Very minor effect on activation by 6-nitrosaccharin or IMNB. [2]
T91 TM3 3.35 T91I Very minor effect on activation by 6-nitrosaccharin or IMNB. [2]
G92 TM3 3.36 G92N Renders receptor sensitive to activation by both IMNB and 6-nitrosaccharin. [2]
G92A Did not significantly increase responsiveness to either IMNB or 6-nitrosaccharin.[2]
K265 TM7 7.39 K265E Loss-of-responsiveness toward the original agonist [1]
R268 TM7 7.42 R268A Loss of responsiveness towards aristolochic acid. Renders the receptor responsive to denatonium (non-cognate ligand). No effect on other non-cognate ligands. [1]
K265,R268A TM7 7.39 K265E ⁄ R268A Double mutant Switching of receptor ligand specificities [1]
EL1 swap EL1 swap with hT2RS43 EL1: Y76N ⁄ V87I ⁄ T91I ⁄ G92N
4 mutations
Renders receptor sensitive to activation by IMNB. [2]
EL2 swap EL2 Swap with hT2RS43 EL2, 11 mutations. Had no effect on IMNB-mediated receptor activation. [2]
El1 + EL2 swap El1 + EL2 Swap with hT2RS43 EL1+EL2. Render Receptor sensitive to activation by IMNB. [2]

[1] Brockhoff, A., et al. (2010) Structural requirements of bitter taste receptor activation, Proc Natl Acad Sci U S A 107 , 11110-11115.

[2] Pronin, A. N., et al. (2004) Identification of Ligands for Two Human Bitter T2R Receptors, Chemical Senses 29, 583-593.

  • See also mutation data for hTAS2R43 which is 88% identical to hTAS2R31.

  • For more information about Structural requirements hTAS2R31 activation and hTAS2R31 Antagonist Binding refer to hTAS2R46 .

Links:

P59538
TAS2R31