BitterDB

hTAS2R44 - Taste receptor type 2 member 44 help

Properties help

  • Human
  • chr12:11,182,986-11,184,006 UCSC
  • 10
  • 35,296 (Da)


  • MTTFIPIIFSSVVVVLFVIGNFANGFIALVNSIERVKRQK ISFADQILTALAVSRVGLLWVLLLNWYSTVFNPAFYSVEV RTTAYNVWAVTGHFSNWLATSLSIFYLLKIANFSNLIFLH LKRRVKSVILVMLLGPLLFLACQLFVINMKEIVRTKEYEG NMTWKIKLRSAVYLSDATVTTLGNLVPFTLTLLCFLLLIC SLCKHLKKMQLHGKGSQDPSTKVHIKALQTVIFFLLLCAV YFLSIMISVWSFGSLENKPVFMFCKAIRFSYPSIHPFILI WGNKKLKQTFLSVLRQVRYWVKGEKPSSP

Known Ligands help

Please scroll down to see the rest of the ligands.

Download SDF file of selected compounds.

3D Homology Model help

Click here to download the model PDB file.

When using this 3D model, please cite us:
Promiscuity and selectivity of bitter molecules and their receptors. Bioorg Med Chem 23 (2015) 4082-4091.
doi: 10.1016/j.bmc.2015.04.025

Protein Diagram help

Receptor snake diagram

When using this 2D protein diagram,please cite us:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper: BitterDB paper

SNPs Table help

ReceptorLocationBW numberResidueMAFdbSNP
TAS2R441.64R35W0.3355rs10845295
TAS2R44EC2L162M0.2993rs10743938
TAS2R44IC3Q217E0.1226rs10845294
TAS2R446.37A227V0.3498rs10845293
TAS2R446.5V240I0.3353rs10772423
TAS2R447.5P276R0.1226rs12318612

Known Mutations Table help

Links and Citations:

P59538
t2r31_human
TAS2R31
ENSG00000256436-TAS2R31

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402