BitterDB

hTAS2R8 - Taste receptor type 2 member 8 help

Properties help

  • Human
  • chr12:10,958,651-10,959,579 UCSC
  • 3
  • 35,877 (Da)


  • MFSPADNIFIILITGEFILGILGNGYIALVNWIDWIKKKK ISTVDYILTNLVIARICLISVMVVNGIVIVLNPDVYTKNK QQIVIFTFWTFANYLNMWITTCLNVFYFLKIASSSHPLFL WLKWKIDMVVHWILLGCFAISLLVSLIAAIVLSCDYRFHA IAKHKRNITEMFHVSKIPYFEPLTLFNLFAIVPFIVSLIS FFLLVRSLWRHTKQIKLYATGSRDPSTEVHVRAIKTMTSF IFFFFLYYISSILMTFSYLMTKYKLAVEFGEIAAILYPLG HSLILIVLNNKLRQTFVRMLTCRKIACMI

Known Ligands help

Download SDF file of selected compounds.

Protein Diagram help

Receptor snake diagram

When using this 2D protein diagram,please cite us:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper: BitterDB paper

Known Mutations Table help

No mutations were reported yet.

Links:

Q9NYW2
TAS2R8