BitterDB

hTAS2R5 - Taste receptor type 2 member 5 help

Properties help

  • Human
  • chr7:141,490,017-141,491,166 UCSC
  • 6
  • 34,505 (Da)


  • MLSAGLGLLMLVAVVEFLIGLIGNGSLVVWSFREWIRKFN WSSYNLIILGLAGCRFLLQWLIILDLSLFPLFQSSRWLRY LSIFWVLVSQASLWFATFLSVFYCKKITTFDRPAYLWLKQ RAYNLSLWCLLGYFIINLLLTVQIGLTFYHPPQGNSSIRY PFESWQYLYAFQLNSGSYLPLVVFLVSSGMLIVSLYTHHK KMKVHSAGRRDVRAKAHITALKSLGCFLLLHLVYIMASPF SITSKTYPPDLTSVFIWETLMAAYPSLHSLILIMGIPRVK QTCQKILWKTVCARRCWGP

Known Ligands help

Please scroll down to see the rest of the ligands.

Download SDF file of selected compounds.

3D Homology Model help

Click here to download the model PDB file.

When using this 3D model, please cite us:
Promiscuity and selectivity of bitter molecules and their receptors. Bioorg Med Chem 23 (2015) 4082-4091.
doi: 10.1016/j.bmc.2015.04.025

Protein Diagram help

Receptor snake diagram

When using this 2D protein diagram,please cite us:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper: BitterDB paper

SNPs Table help

ReceptorLocationBW numberResidueMAFdbSNP
TAS2R5IC1S26I0.4525rs2227264

Known Mutations Table help

No mutations were reported yet.

Links and Citations:

Q9NYW4
ta2r5_human
TAS2R5
ENSG00000127366-TAS2R5

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402