hTAS2R5 - Human (Homo sapiens) Taste Receptor Type 2 Member 5
Links and Citations:
Properties
- Human
- chr7:141,490,017-141,491,166 UCSC
- 35
- 34,505 (Da)
-
MLSAGLGLLMLVAVVEFLIGLIGNGSLVVWSFREWIRKFN WSSYNLIILGLAGCRFLLQWLIILDLSLFPLFQSSRWLRY LSIFWVLVSQASLWFATFLSVFYCKKITTFDRPAYLWLKQ RAYNLSLWCLLGYFIINLLLTVQIGLTFYHPPQGNSSIRY PFESWQYLYAFQLNSGSYLPLVVFLVSSGMLIVSLYTHHK KMKVHSAGRRDVRAKAHITALKSLGCFLLLHLVYIMASPF SITSKTYPPDLTSVFIWETLMAAYPSLHSLILIMGIPRVK QTCQKILWKTVCARRCWGP
Known Ligands 
Please scroll down to see the rest of the ligands.
Download SDF file of selected compounds.
Experimental/ Computational 3D structures 
Here are links to the 3D structures of the receptors. If an experimental structure is available, it is recommended to use the RCSB PDB link. Otherwise, you can use the computationally predicted AlphaFold 3D model.
Protein Diagram 
When using this 2D protein diagram,please cite us:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper:
BitterDB paper
SNPs Table 
| Receptor | Location | BW number | Residue | MAF | dbSNP |
| TAS2R5 | IC1 | S26I | 0.4525 | rs2227264 |
Known Mutations Table 
No mutations were reported yet.
Known SNP Table 
| Receptor | Location | BW number | Residue | MAF | dbSNP |
| hTAS2R5 | 0 | G20S | 0 | rs2234013 | |
| hTAS2R5 | 0 | P113L | 0 | rs2234014 | |
| hTAS2R5 | 0 | R213Q | 0 | rs2234015 | |
| hTAS2R5 | 0 | R294L | 0 | rs2234016 | |
| hTAS2R5 | IC1 | 0 | S26I | 0.4525 | rs2227264 |
| hTAS2R5 | 0 | Y167C | 0 | rs34529840 |
