BitterDB

Institute of Biochemistry, Food Science and Nutrition, Faculty of Agriculture,

The Hebrew University of Jerusalem האוניברסיטה העברית ירושלים

huji_logo

  • Home |
  • Contact |
  • About|
  • The Niv Lab
  • Search
    • Compounds
    • Receptors
  • Browse
    • Compounds
    • Receptors
  • Catalog
  • Tools
    • Blast
    • Alignment
  • Links
  • Upload
  • Help
  • Examples

Welcome to BitterDB!

Humans perceive numerous compounds as bitter. The bitterness of a compound often provides a hint to its potential toxicity, and aversion from bitterness helps refrain from consuming poisons. Well known example is strychnine. Some other bitter compounds, such as caffeine, while toxic in high dosages, are palatable and are consumed in large quantities. The amount of bitter compounds is estimated in thousands. But what are these compounds? How similar or different are their chemical properties? Do they act on the same or on different receptors? Is it possible to predict bitterness of a molecule?

To enable investigation into these intriguing questions, we established BitterDB, a free and searchable database of bitter compounds.

How to Cite BitterDB:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper: BitterDB paper

BitterDB currently holds over 570 bitter compounds obtained from the literature and from Merck index and their associated 25 human bitter taste receptors (hT2Rs).

BitterDB provides several ways to investigate the bitter world: search for bitter compounds by different criteria, search for bitter molecules with structure similar to a query compound, blast bitter receptors and more.

New! 2D plots of bitter receptors are available in the receptors pages.

go to : compounds search >>

go to : Receptor search >>


If you would like to receive information about new uploads to the database, please fill your email in the mailing list below.

  Email:

 Our goal is to make this site user-friendly and easy to use.
 This site is best viewed in Firefox, Opera, Chrome and Safari browsers.
 Please make sure Java Scripts are enabled in your browser: javatester.

Blast Receptors help

(in Fasta format) help

More Parameters arrow

help

General Parameters:
Scoring Parameters:
Filters:


Human Bitter Receptors Alignment help

The alignment contains the sequences of the 25 human bitter taste receptors. It shows the secondary structure for each receptor as predicted by TOPCONS [1].In each trans-membrane helix X, the most conserved residue in family A GPCRs (X.50 in Ballesteros-Weinstein numbering) is indicated. The alignment was generated by Anat Levit using the PROMALS3D [2]. webserver based on 3D structural information from 11 sequence-distinct family A GPCRs. For more information click on the help icon.


References:

  1. Hennerdal A, Elofsson A (2011) Rapid membrane protein topology prediction. Bioinformatics. 27(9):1322-3. PubMedID: 21493661
  2. Pei, J., B.H. Kim, and N.V. Grishin.(2008) PROMALS3D: a tool for multiple protein sequence and structure alignments. Nucleic Acids Res 36(7): p. 2295-300. PubMedID: 18287115

Browse Receptors help


BitterDB Receptor IDShort NameOrganismProtein NameAdditional NamesNumber Of LigandsMutation data
1 TAS2R1 Human Taste receptor type 2 member 1 TRB7 Taste receptor family B member 7 27 -
3 TAS2R3 Human Taste receptor type 2 member 3 1 -
4 TAS2R4 Human Taste receptor type 2 member 4 15 -
5 TAS2R5 Human Taste receptor type 2 member 5 1 -
7 TAS2R7 Human Taste receptor type 2 member 7 TRB4 Taste receptor family B member 4 6 -
8 TAS2R8 Human Taste receptor type 2 member 8 TRB5 Taste receptor family B member 5 3 -
9 TAS2R9 Human Taste receptor type 2 member 9 TRB6 Taste receptor family B member 6 3 -
10 TAS2R10 Human Taste receptor type 2 member 10 TRB2 Taste receptor family B member 2 31 -
13 TAS2R13 Human Taste receptor type 2 member 13 TRB3 Taste receptor family B member 3 2 -
14 TAS2R14 Human Taste receptor type 2 member 14 TRB1 Taste receptor family B member 1 43 -
16 TAS2R16 Human Taste receptor type 2 member 16 9 +
38 TAS2R38 Human Taste receptor type 2 member 38 PTC bitter taste receptor, Taste receptor type 2 member 61 T2R61 21 +
39 TAS2R39 Human Taste receptor type 2 member 39 Taste receptor type 2 member 57 T2R57 10 -
40 TAS2R40 Human Taste receptor type 2 member 40 Taste receptor type 2 member 58 T2R58, GPR60 G- protein coupled receptor 60 10 -
41 TAS2R41 Human Taste receptor type 2 member 41 Taste receptor type 2 member 59 T2R59 0 -
42 TAS2R42 Human Taste receptor type 2 member 42 Taste receptor type 2 member 55 T2R55 0 -
43 TAS2R43 Human Taste receptor type 2 member 43 Taste receptor type 2 member 52 T2R52 16 +
44 TAS2R44 Human Taste receptor type 2 member 44 Taste receptor type 2 member 31 T2R31, Taste receptor type 2 member 53 T2R53 8 +
45 TAS2R45 Human Taste receptor type 2 member 45 G-protein coupled receptor 59 GPR59 0 -
46 TAS2R46 Human Taste receptor type 2 member 46 Taste receptor type 2 member 54 T2R54 27 +
47 TAS2R47 Human Taste receptor type 2 member 47 Taste receptor type 2 member 30 TAS2R30 10 +
48 TAS2R48 Human Taste receptor type 2 member 48 Taste receptor type 2 member 23 T2R23, Taste receptor type 2 member 19 T2R19 0 -
49 TAS2R49 Human Taste receptor type 2 member 49 Taste receptor type 2 member 20 TAS2R20 ,Taste receptor type 2 member56 T2R56 2 -
50 TAS2R50 Human Taste receptor type 2 member 50 Taste receptor type 2 member 51 T2R51 2 -
60 TAS2R60 Human Taste receptor type 2 member 60 Taste receptor type 2 member 56 T2R56 0 -

Browse BitterDB Compounds help


new Catalog

Contact us

To contact us please send email to nivlab@agri.huji.ac.il
Any suggestions and comments will be highly appreciated!


Reference for citation:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419
Click here to view the paper: BitterDB paper


Thank you!
BitterDB team

Version 1.1

Release date: December,2012


BitterDB Team

Ayana Wiener, Marina Shudler, Anat Levit and Dr. Masha Y Niv


Reference for citation:

Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419
Click here to view the paper: BitterDB paper

  • The Hebrew University
  • Faculty of Agriculture
  • Fritz Haber Center for Molecular Dynamics
  • PubChem
  • ZINC
  • GeneCards

  We are interested in extending the BitterDB database.
  If you are aware of any bitter compounds that are not included in this database,
  please upload them below or send them via email to: nivlab@agri.huji.ac.il
  Please note that fields with * are required.

  Thank you!
  BitterDB team

  Name of molecule/compound:
*

  

  Smiles of molecule/compound:
  

  Resource of molecule/compound (please cite the name of the paper/database/publication):
*


  PubMed ID of the resource:
  

  Comment:

  Your name:
*

  

  Your email:
*

  

 

Help - How to use BitterDB

The BitterDB contains information to maximize the utility of the resource. To get help for specific part just click the help icon which appear next to it. Clicking it will open a popup window with the help. All the help for this site is also available on this page.

How to cite BitterDB:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds.
Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper: BitterDB paper

Table of Content


  • Compounds search
    • Simple Compound Search
    • BitterDB Advanced Search
      • Search by Physical Properties
      • Search by Identifiers
      • Search by Receptors
    • Structure similarity search
  • Search results
  • Receptor Search
  • Browse BitterDB compounds
  • Browse BitterDB receptors
  • Local BLAST Service
    • How to input your sequence
    • BLAST parameters
  • Human Bitter Receptors Alignment
  • BitterDB Compound Entry
  • BitterDB Receptor Entry



Simple Compound Search


To Search BitterDB Compounds enter your query in the search box and click search. You can enter compound name, smiles, CAS name or number, Formula, IUPAC Name and properties. For search by specific criteria please go to advanced search. The simple search is implemented as what is sometimes referred to as "implied Boolean logic", meaning that certain characters have special meaning at the beginning or end of words, such as.

  • + stands for AND
  • - stands for NOT
  • [no operator] implies OR
  • The asterisk serves as the truncation (or wildcard) operator. It should be appended to the word to be affected. Words match if they begin with the word preceding the * operator.

Click here for more information about "implied Boolean logic".


BitterDB Advanced Search


This search form contains a number of fields, all of which are optional (although at least one field is needed to perform a search). The entered search terms 'ANDed' together, meaning that the compounds that are found comply with ALL the terms that were specified.

The BitterDB allows searching compounds by the following physical properties that were computed by 'Discovery Studio v2.5.5 (Accelrys, Inc.) for each compound:

  • Log of the octanol-water partition coefficient using Ghose and Crippen's method.[1]
  • Molecular solubility expressed as logS, where S is the solubility in mol/L. The method used to estimate the solubility is the published multiple linear regression model by Tetko et al.[2]
  • Hydrogen Bond Acceptors are defined as heteroatoms (Oxygen, Nitrogen, Sulfur, or Phosphorus) with one or more lone pairs, excluding atoms with positive formal charges, amide and pyrrole-type Nitrogens, and aromatic Oxygen and Sulfur atoms in heterocyclic rings.
  • Hydrogen Bond Donors are defined as heteroatoms (Oxygen, Nitrogen, Sulfur, or Phosphorus) with one or more attached Hydrogen atoms.

The Natural property indicates if the compound is natural or synthetic. This property (where available) was obtained from the literature.


  1. Ghose, A. K.; Crippen, G. Atomic physicochemical parameters for three-dimensional structure-directed quantitative structure-activity relationships I. Partition coefficient as a measure of hydrophobicity. J. Comp. Chem. 1986, 7, 565-577.
  2. Tetko, I. V.; Tanchuk, V. Yu.; Kasheva, T. N; Villa, A. E. P.; J. Chem. Inf. Comput. Sci., 2001, 41(6), 1488-1493.

The BitterDB allows searching bitter compounds using different textual keywords. BitterDB can be searched by:

  • - IUPAC name
  • - CAS Registry number (add link)
  • - Simplified Molecular Input Line Entry Specification is a specification for unambiguously describing the structure of chemical molecules using short ASCII strings

The BitterDB allows searching compounds by their associated receptors.
Checking more than one box is equivalent for asking for ligands of at least one of the receptors that were checked. The disable receptors options are receptors that are still orphan (i.e receptors with no known ligands).


Structure Similarity Search


2D Structure Similarity Search allows to locate records that are similar to a chemical structure query.
you can draw a molecule or you can insert a valid SMILES string in the upper box.
Similarity is measured by the Tanimoto equation and the fingerprint. This fingerprint consists of series of chemical substructure "keys". Each key denotes the presence or absence of a particular substructure in a molecule. The fingerprint does not consider variation in stereochemical or isotopic information. Collectively, these binary keys provide a "fingerprint" of a particular chemical structure valence-bond form. We used openBabel [1] for calculating MACCS fingerprints and for the similarity search.

References

    • Rajarshi Guha, Michael T. Howard, Geoffrey R. Hutchison, Peter Murray-Rust, Henry Rzepa, Christoph Steinbeck, Joerg Kurt Wegner, Egon Willighagen. "The Blue Obelisk -- Interoperability in Chemical Informatics." J. Chem. Inf. Model. (2006) 46(3) 991-998.
    • The Open Babel Package, version 2.3.3 http://openbabel.sourceforge.net/


Search results


The Results to your search are sort by their bitterDB id. In order to get a full compound entry click on the compound id or it's name. It is possible also to download a SDF file of selected compound, check the required compounds and click on the download button in the top right of the page.


Receptor Search


To search BitterDB Receptors enter the query terms in the search box and click search. The BitterDB allows searching bitter receptors using different criteria:

Receptor Name:

Search bitter Receptors by its Gene name, Protein Name or other common name the receptor is associated with. For example, Taste receptor type 2 member 38 can be searched by the following keywords: hTAS2R38, TAS2R38, T2R38,T2R61, TAS2R61, hTAS2R61, Taste receptor type 2 member 61, PTC, PTC bitter taste receptor. This search option is implemented via the "implied Boolean logic".

Ligand Name:

Search bitter receptors by their associated ligand. For example, the results of the search term "caffeine" are five different bitter receptors. The search option is implemented via the implied Boolean logic".

UniProtKB accession number:

Search bitter receptors by their UniProtKB accession number.


This search form contains two more fields:

Has Mutation:

Search bitter Receptors which have/have not mutation data.

Has Ligands:

Search bitter Receptors which have known ligands or those that are orphan receptors.

If these fields are used with a term in the top search box they are 'ANDed' together, meaning that the receptors that are found comply with ALL the terms that were specified.


Boolean logic

  • + stands for AND
  • - stands for NOT
  • [no operator] implies OR
  • The asterisk serves as the truncation (or wildcard) operator. It should be appended to the word to be affected. Words match if they begin with the word preceding the * operator.

Click here or more information about "implied Boolean logic".


Browse BitterDB compounds


The user may use the 'Browse BitterDB Compounds' option to browse through a table with all BitterDB compounds and their properties. The compounds can be sorted by different criteria: BitterDB ID, number of associated receptors, molecular weight, logP and more, by clicking the arrows in the columns names. The search box on the top right hand side of the table enables searching for specific compounds in the compound table. The search option is implemented such, that it filters the relevant results as soon as the search term is typed. Clicking on a specific compound name opens the compound entry page.


Browse BitterDB receptors


The user may use the 'Browse BitterDB Receptors' option to browse through a table of the 25 human bitter taste receptors. For each receptor, its alternative names, the number of bitter ligands that it is known to bind and availability of mutational data, are indicated. The receptors can be sorted according to different criteria: BitterDB receptor ID, number of associated bitter ligands, receptor name and more, by clicking the arrows in the columns names. The search box on the top right hand side of the table enables searching for specific receptors. The search option is implemented such that it filters the relevant results as soon as the search term is typed. Clicking on a specific receptor name opens the receptor entry page.


Local BLAST service


BitterDB contains local BLAST service to find local similarity between the query sequence and Human Bitter Receptors. For more detailed information on what happens behind the scenes, look at this Wikipedia article.

Query sequence to be used for a BLAST search should be pasted in the text area. The sequence should be amino acids sequences in FASTA format.

for example:
>sp|Q646B7|T2R14_PANTR Taste receptor type 2 member 14
MGGVIKSIFTFVLIVEFIIGNLGNSFIALVNCIDWVKGRKISSVDRILTALAISKISLVW
LIFGSWCVSVFFPALFATEKMFRMLTNIWTVINHFSVWLATGLGTFYFLKIANFSNSIFL
YLKWRVKKVVLVLLLVTSVFLFLNIALINIHINASINGYRRNKTCSSDSSNFTRFSSLIV
LTSTVFIFIPFTLSLAMFLLLIFSXWKHRKKMQHTVKRSGDASTKAHRGVKSVXTFFLLY
AIFCLSFFISVWTSERLEENLIILSQVMGMAYPSCHSCVLILGNKKLRQASLSVLLWLRY
MFKDGEPSGHKEFRESS


BLAST Algorithm parameters may be adjusted to make them suitable to the query.

Click on the blue arrow to see the additional parameters

Word-size:

BLAST is a heuristic that works by finding word-matches between the query and database sequences. One may think of this process as finding "hot-spots" that BLAST can then use to initiate extensions that might eventually lead to full-blown alignments. For BLASTp searches non-exact word matches are taken into account based upon the similarity between words. The amount of similarity can be varied so one normally uses just the word-sizes 2 and 3 for these searches.

Expect:

This setting specifies the statistical significance threshold for reporting matches against database sequences. The default value (10) means that 10 such matches are expected to be found merely by chance, according to the stochastic model of Karlin and Altschul (1990). If the statistical significance ascribed to a match is greater than the EXPECT threshold, the match will not be reported. Lower EXPECT thresholds are more stringent, leading to fewer chance matches being reported.

Matrix:

A key element in evaluating the quality of a pairwise sequence alignment is the "substitution matrix", which assigns a score for aligning any possible pair of residues. The matrix used in a BLAST search can be changed depending on the type of sequences you are searching with. See more information on BLAST substitution matrices.

Gap Cost:

The pull down menu shows the Gap Costs for the chosen Matrix. There can only be a limited number of options for these parameters. Increasing the Gap Costs will result in alignments which decrease the number of Gaps introduced.

Filter (Low-complexity):

This function mask off segments of the query sequence that have low compositional complexity, as determined by the SEG program of Wootton and Federhen (Computers and Chemistry, 1993). Filtering can eliminate statistically significant but biologically uninteresting reports from the blast output (e.g. hits against common acidic-, basic- or proline-rich regions), leaving the more biologically interesting regions of the query sequence available for specific matching against database sequences. See more information on BLAST Search Parameters help.


Human Bitter taste Receptors Alignment


The Alignment contains the 25 human bitter taste receptors, it is displayed with JalView [1] which permits editing of the alignment. By right-clicking the receptor name, a new window with the BitterDB entry for this receptor opens. The alignment shows the predicted secondary structure for each receptor as predicted by TOPCONS [2]. In each trans-membrane helix X, the most conserved residue (X.50 in Ballesteros-Weinstein numbering) [3] is colored in yellow, following the assignment in Niv et el. [4] The alignment was generated by Anat Levit using the PROMALS3D webserver [5]. It was generated with 11 sequence-distinct family A GPCRs, for which a crystal structure has been solved. .


References:

  1. Waterhouse, A.M., Procter, J.B., Martin, D.M.A, Clamp, M. and Barton, G. J.(2009) Jalview Version 2 - a multiple sequence alignment editor and analysis workbench. Bioinformatics 25 (9) 1189-1191 doi: 10.1093/bioinformatics/btp033
  2. Hennerdal A, Elofsson A (2011) Rapid membrane protein topology prediction. Bioinformatics. 27(9):1322-3. PubMedID: 21493661
  3. Ballesteros J, Weinstein H (1995) Integrated methods for the construction of three- dimensional models of structure-function relations in G protein-coupled receptors. Methods Neurosci 25:366-428.
  4. Brockhoff A, Behrens M, Niv MY, Meyerhof W (2010) Structural requirements of bitter taste receptor activation.(2010) Proc Natl Acad Sci U S A 107, (24), 11110-5.
  5. Pei, J., B.H. Kim, and N.V. Grishin.(2008) PROMALS3D: a tool for multiple protein sequence and structure alignments. Nucleic Acids Res 36(7): p. 2295-300. PubMedID: 18287115



Search Results help

Simple Search | Advanced Search | Structure Search

Advanced Search >>


How to cite BitterDB:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds.
Nucleic Acids Res 2012, 40(Database issue):D413-419

Structure Similarity Search: help


Advanced Search help


Properties: help

from: to: from: to:
from: to: from: to:
from: to:   from: to:
  from: to:

Identifiers: help

Trivial Name or Synonym   Systematic Name   Registry Number   SMILES   molecular Formula   BitterDB ID

Bitter Receptors: help

Receptor Search help

In Human There are 25 known different bitter receptors

Search By: Term:
 
coffeeCup coffeeMol coffeeRecep

© 2011 The Hebrew University of Jerusalem| website templates by styleshout
BitterDB publication | Last Updated On 26.12.2012