BitterDB

hTAS2R49 - Taste receptor type 2 member 49 help

Properties help

  • Human
  • chr12:11,148,561-11,150,474 UCSC
  • 2
  • 35,358 (Da)


  • MMSFLHIVFSILVVVAFILGNFANGFIALINFIAWVKRQK ISSADQIIAALAVSRVGLLWVILLHWYSTVLNPTSSNLKV IIFISNAWAVTNHFSIWLATSLSIFYLLKIVNFSRLIFHH LKRKAKSVVLVIVLGSLFFLVCHLVMKHTYINVWTEECEG NVTWKIKLRNAMHLSNLTVAMLANLIPFTLTLISFLLLIY SLCKHLKKMQLHGKGSQDPSTKIHIKALQTVTSFLILLAI YFLCLIISFWNFKMRPKEIVLMLCQAFGIIYPSFHSFILI WGNKTLKQTFLSVLWQVTCWAKGQNQSTP

Known Ligands help

Download SDF file of selected compounds.

Protein Diagram help

Receptor snake diagram

When using this 2D protein diagram,please cite us:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper: BitterDB paper

Known Mutations Table help

No mutations were reported yet.

Links:

P59543
TAS2R20