BitterDB

hTAS2R45 - Taste receptor type 2 member 45 help

Properties help

  • Human
  • chr12:1653159-1652260
  • 0
  • 34,278 (Da)


  • MITFLPIIFSILVVVTFVIGNFANGFIALVNSTEWVKRQK ISFADQIVTALAVSRVGLLW VLLLNWYSTVLNPAFCSV ELRTTAYNIWAVTGHFSNWPATSLSIFYLLKIANFSNLIF LR LKRRVKSVILVVLLGPLLFLACHLFVVNMNQIVWTK EYEGNMTWKIKLRRAMYLSDTTVT MLANLVPFTVTLIS FLLLVCSLCKHLKKMQLHGKGSQDPSTKVHIKVLQTVISF FLLRAI YFVSVIISVWSFKNLENKPVFMFCQAIGFSCS SAHPFILIWGNKKLKQTYLSVLWQMRY

Known Ligands help

No ligand has been identified.

Protein Diagram help

Receptor snake diagram

When using this 2D protein diagram,please cite us:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper: BitterDB paper

Known Mutations Table help

No mutations were reported yet.

Links:

P59539
TAS2R45