BitterDB

hTAS2R45 - Taste receptor type 2 member 45 help

Properties help

  • Human
  • chr12:1653159-1652260
  • 0
  • 34,278 (Da)


  • MITFLPIIFSILVVVTFVIGNFANGFIALVNSTEWVKRQK ISFADQIVTALAVSRVGLLW VLLLNWYSTVLNPAFCSV ELRTTAYNIWAVTGHFSNWPATSLSIFYLLKIANFSNLIF LR LKRRVKSVILVVLLGPLLFLACHLFVVNMNQIVWTK EYEGNMTWKIKLRRAMYLSDTTVT MLANLVPFTVTLIS FLLLVCSLCKHLKKMQLHGKGSQDPSTKVHIKVLQTVISF FLLRAI YFVSVIISVWSFKNLENKPVFMFCQAIGFSCS SAHPFILIWGNKKLKQTYLSVLWQMRY

Known Ligands help

No ligand has been identified.

3D Homology Model help

No model available yet.

Protein Diagram help

Receptor snake diagram

When using this 2D protein diagram,please cite us:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper: BitterDB paper

SNPs Table help

ReceptorLocationBW numberResidueMAFdbSNP
TAS2R454.49V132Mrs11526470
TAS2R456.48C238Rrs3759245

Known Mutations Table help

No mutations were reported yet.

Links and Citations:

P59539
t2r45_human
TAS2R45

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402