BitterDB

hTAS2R42 - Taste receptor type 2 member 42 help

Properties help

  • Human
  • chr12:11,338,599-11,339,543 UCSC
  • 0
  • 36,195 (Da)


  • MATELDKIFLILAIAEFIISMLGNVFIGLVNCSEGIKNQK VFSADFILTCLAISTIGQLL VILFDSFLVGLASHLYTT YRLGKTVIMLWHMTNHLTTWLATCLSIFYFFKIAHFPHSL FL WLRWRMNGMIVMLLILSLFLLIFDSLVLEIFIDISL NIIDKSNLTLYLDESKTLYDKLSI LKTLLSLTSFIPFS LFLTSLLFLFLSLVRHTRNLKLSSLGSRDSSTEAHRRAMK MVMSFL FLFIVHFFSLQVANGIFFMLWNNKYIKFVMLA LNAFPSCHSFILILGNSKLRQTAVRLLW HLRNYTKTPN ALPL

Known Ligands help

No ligand has been identified.

3D Homology Model help

Click here to download the model PDB file.

When using this 3D model, please cite us:
Promiscuity and selectivity of bitter molecules and their receptors. Bioorg Med Chem 23 (2015) 4082-4091.
doi: 10.1016/j.bmc.2015.04.025

Protein Diagram help

Receptor snake diagram

When using this 2D protein diagram,please cite us:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper: BitterDB paper

SNPs Table help

ReceptorLocationBW numberResidueMAFdbSNP
TAS2R42EC2 Y175F0.4593rs35969491
TAS2R425.54S196F0.4593rs5020531
TAS2R42EC3 G255W0.2392rs1669413
TAS2R42EC3 Y265C0.22rs1451772
TAS2R42R292Q0.22rs1669412
TAS2R42N310K0.2392rs1669411
TAS2R42A311P0.2392rs1650017

Known Mutations Table help

No mutations were reported yet.

Links and Citations:

Q7RTR8
t2r42_human
TAS2R42
ENSG00000186136-TAS2R42

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402