BitterDB

hTAS2R39 - Taste receptor type 2 member 39 help

Properties help

  • Human
  • chr7:142,880,512-142,881,527 UCSC
  • 84
  • 38,626 (Da)


  • MLGRCFPPDTKEKQQLRMTKLCDPAESELSPFLITLILAV LLAEYLIGIIANGFIMAIHAAEWVQNKAVSTSGRILVFLS VSRIALQSLMMLEITISSTSLSFYSEDAVYYAFKISFIFL NFCSLWFAAWLSFFYFVKIANFSYPLFLKLRWRITGLIPW LLWLSVFISFSHSMFCINICTVYCNNSFPIHSSNSTKKTY LSEINVVGLAFFFNLGIVTPLIMFILTATLLILSLKRHTL HMGSNATGSNDPSMEAHMGAIKAISYFLILYIFNAVALFI YLSNMFDINSLWNNLCQIIMAAYPASHSILLIQDNPGLRR AWKRLQLRLHLYPKEWTL

Known Ligands help

3D Homology Model help

Click here to download the model PDB file.

When using this 3D model, please cite us:
Promiscuity and selectivity of bitter molecules and their receptors. Bioorg Med Chem 23 (2015) 4082-4091.
doi: 10.1016/j.bmc.2015.04.025

Protein Diagram help

Receptor snake diagram

When using this 2D protein diagram,please cite us:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper: BitterDB paper

SNPs Table help

No SNPs were reported yet.

Known Mutations Table help

ReceptorLocationBW numberResidueReferences
TAS2R39TM33.32F117doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1371/journal.pone.0118200
TAS2R39TM33.33I118doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1371/journal.pone.0118200
TAS2R39TM33.36N121doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1371/journal.pone.0118200
TAS2R39TM33.37F122doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1371/journal.pone.0118200
TAS2R39TM33.4L125doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1371/journal.pone.0118200
TAS2R39TM44.56F170doi: 10.1371/journal.pone.0118200
TAS2R39TM55.4A210doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1371/journal.pone.0118200
TAS2R39TM55.41F211doi: 10.1371/journal.pone.0118200
TAS2R39TM55.44N214doi: 10.1371/journal.pone.0118200
TAS2R39TM55.45L215doi: 10.1371/journal.pone.0118200
TAS2R39TM66.48I272doi: 10.1371/journal.pone.0118200
TAS2R39TM66.51A275doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1371/journal.pone.0118200
TAS2R39TM66.52V276doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1371/journal.pone.0118200
TAS2R39TM66.55F279doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1371/journal.pone.0118200
TAS2R39TM66.56I280doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1371/journal.pone.0118200
TAS2R39TM77.35N293doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1371/journal.pone.0118200
TAS2R39TM77.39Q297doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1371/journal.pone.0118200
TAS2R39TM77.45Y303doi: 10.1371/journal.pone.0118200

Links and Citations:

P59534
t2r39_human
TAS2R39
ENSG00000236398-TAS2R39

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402