BitterDB

hTAS2R39 - Taste receptor type 2 member 39 help

Properties help

  • Human
  • chr7:142,880,512-142,881,527 UCSC
  • 78
  • 38,626 (Da)


  • MLGRCFPPDTKEKQQLRMTKLCDPAESELSPFLITLILAV LLAEYLIGIIANGFIMAIHAAEWVQNKAVSTSGRILVFLS VSRIALQSLMMLEITISSTSLSFYSEDAVYYAFKISFIFL NFCSLWFAAWLSFFYFVKIANFSYPLFLKLRWRITGLIPW LLWLSVFISFSHSMFCINICTVYCNNSFPIHSSNSTKKTY LSEINVVGLAFFFNLGIVTPLIMFILTATLLILSLKRHTL HMGSNATGSNDPSMEAHMGAIKAISYFLILYIFNAVALFI YLSNMFDINSLWNNLCQIIMAAYPASHSILLIQDNPGLRR AWKRLQLRLHLYPKEWTL

Known Ligands help

Please scroll down to see the rest of the ligands.

Protein Diagram help

Receptor snake diagram

When using this 2D protein diagram,please cite us:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper: BitterDB paper

Known Mutations Table help

No mutations were reported yet.

Links:

P59534
TAS2R39