BitterDB

hTAS2R38 - Taste receptor type 2 member 38 help

Properties help

  • Human
  • chr7:141,672,431-141,673,573 UCSC
  • 21
  • 37,892 (Da)


  • MLTLTRIRTVSYEVRSTFLFISVLEFAVGFLTNAFVFLVN FWDVVKRQALSNSDCVLLCLSISRLFLHGLLFLSAIQLTH FQKLSEPLNHSYQAIIMLWMIANQANLWLAACLSLLYCSK LIRFSHTFLICLASWVSRKISQMLLGIILCSCICTVLCVW CFFSRPHFTVTTVLFMNNNTRLNWQIKDLNLFYSFLFCYL WSVPPFLLFLVSSGMLTVSLGRHMRTMKVYTRNSRDPSLE AHIKALKSLVSFFCFFVISSCAAFISVPLLILWRDKIGVM VCVGIMAACPSGHAAILISGNAKLRRAVMTILLWAQSSLK VRADHKADSRTLC

Known Ligands help

Please scroll down to see the rest of the ligands.

Protein Diagram help

Receptor snake diagram

When using this 2D protein diagram,please cite us:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper: BitterDB paper

Known Mutations Table help

Residue Location Ballesteros-Weinstein: Mutation Experimental data References
W99 TM3 3.32 W99V Increase in receptor activation [1]
W99A Decrease in receptor activation
M100 TM3 3.33 M100A No significant difference in EC50 values, maximum activity higher than WT [1]
M100V
N103 TM3 3.36 N103A Increase in EC50 values [1]
N103V Increase in EC50 values, decrease in receptor activation
F255 TM6 6.43 F255V Roughly maintains the extrapolated EC50 value with respect to WT, The dose-response curve does not saturate [1]
F255,V296   TM6,TM7 6.43,7.52 F255V/V296F   The dose-response profile of the double mutant is identical to the WT [1]
S259 TM6 6.47 S259A Low receptor activation levels [1]
S259V

[1] Biarnés, X. et al. Insights into the binding of Phenyltiocarbamide (PTC) agonist to its target human TAS2R38 bitter receptor. PloS one 5, e12394(2010). PubMed: 20811630

Links:

P59533
TAS2R38