BitterDB

hTAS2R38 - Taste receptor type 2 member 38 help

Properties help

  • Human
  • chr7:141,672,431-141,673,573 UCSC
  • 23
  • 37,892 (Da)


  • MLTLTRIRTVSYEVRSTFLFISVLEFAVGFLTNAFVFLVN FWDVVKRQALSNSDCVLLCLSISRLFLHGLLFLSAIQLTH FQKLSEPLNHSYQAIIMLWMIANQANLWLAACLSLLYCSK LIRFSHTFLICLASWVSRKISQMLLGIILCSCICTVLCVW CFFSRPHFTVTTVLFMNNNTRLNWQIKDLNLFYSFLFCYL WSVPPFLLFLVSSGMLTVSLGRHMRTMKVYTRNSRDPSLE AHIKALKSLVSFFCFFVISSCAAFISVPLLILWRDKIGVM VCVGIMAACPSGHAAILISGNAKLRRAVMTILLWAQSSLK VRADHKADSRTLC

Known Ligands help

3D Homology Model help

Click here to download the model PDB file.

When using this 3D model, please cite us:
Promiscuity and selectivity of bitter molecules and their receptors. Bioorg Med Chem 23 (2015) 4082-4091.
doi: 10.1016/j.bmc.2015.04.025

Protein Diagram help

Receptor snake diagram

When using this 2D protein diagram,please cite us:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper: BitterDB paper

SNPs Table help

ReceptorLocationBW numberResidueMAFdbSNP
TAS2R38IC1A49P0.4952rs713598
TAS2R386.54V262A0.4255rs1726866
TAS2R387.52I296V0.4794rs10246939

Known Mutations Table help

ReceptorLocationBW numberResidueReferences
TAS2R38TM33.32W99doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: doi: 10.1371/journal.pone.0064675 doi: 10.3389/fmolb.2017.00063 doi: 10.1016/j.jsamd.2017.03.001
TAS2R38TM33.33M100doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1371/journal.pone.0064675 doi: 10.3389/fmolb.2017.00063 doi: 10.1016/j.jsamd.2017.03.001
TAS2R38TM33.36N103doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: doi: 10.1371/journal.pone.0064675 doi: 10.3389/fmolb.2017.00063 doi: 10.1016/j.jsamd.2017.03.001
TAS2R38EC25.24N179doi: 10.3389/fmolb.2017.00063 doi: 10.1016/j.jsamd.2017.03.001
TAS2R38EC25.26R181doi: 10.3389/fmolb.2017.00063 doi: 10.1016/j.jsamd.2017.03.001
TAS2R38EC25.28N183doi: 10.3389/fmolb.2017.00063 doi: 10.1016/j.jsamd.2017.03.001
TAS2R38TM55.42F197doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1371/journal.pone.0064675 doi: 10.3389/fmolb.2017.00063 doi: 10.1016/j.jsamd.2017.03.001
TAS2R38TM55.46W201doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1371/journal.pone.0064675 doi: 10.3389/fmolb.2017.00063 doi: 10.1016/j.jsamd.2017.03.001
TAS2R38TM66.47F255doi: 10.3389/fmolb.2017.00063
TAS2R38TM66.51S259doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1371/journal.pone.0064675 doi: 10.1016/j.jsamd.2017.03.001
TAS2R38TM66.52S260doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1371/journal.pone.0064675
TAS2R38TM66.56F264doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1371/journal.pone.0064675 doi: 10.3389/fmolb.2017.00063 doi: 10.1016/j.jsamd.2017.03.001
TAS2R38TM77.52I296doi: 10.1371/journal.pone.0012394

Links and Citations:

P59533
t2r38_human
TAS2R38
ENSG00000257138-TAS2R38

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402