BitterDB

fTas2r46 - Taste receptor type 2 member 46 help

Properties help

  • Cat
  • chrB4:47,476,955-47,477,881
  • 6
  • (Da)


  • MVSALPSIFSIAVIIEFLLGNFANGFIALVNFIDWTKRQK ISSVDHILAALAVSRIGLLWVMIINWYATWFSPDFKSLEV RIIFQIAWTVSNHFSIWLATSLSIFYLFKIANFSSLIFLR LKWRVKSIVLVMLLGSLFLLFSHVAAVSIYEKVQTKAYEG NVTWRTKWTGMAHLSNMTVFTLANFIPFATSLTSFVLLIF SLWRHLKRMQLCGKGSQDPSTKVHIRAMQTVVSFLLFFAG YVLNLIVTIWSFNGLQKELFMFCQVLAFVYPSIHSLMLIW GNKKLKQAFLSVLYQEKYWLKEQKHSTP

Known Ligands help

Please scroll down to see the rest of the ligands.

Download SDF file of selected compounds.

3D Homology Model help

No model available yet.

Links and Citations:

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402