BitterDB

fTas2r38 - Taste receptor type 2 member 38 help

Properties help

  • Cat
  • chrA2:158,053,039-158,054,043
  • 2
  • 37,305 (Da)


  • MLALTPVITVSYEVKSAFLFLSILEFTVGVLANAFIFLVN FWDVVRKQPLSNCDLILLSLSLTRLFLHGLLFLDALQLTY FQRMKDPLSLSYQTIIMLWMITNQVGLWLTTCLSLLYCSK IARFSHTLLHCVASWVSRKVPQMLLGAMLFSCICTAICLG DFFSRSGFTFTTMLFVNNTEFNLQIAKLSFYHSFIFCTLA SIPSLLFFLVSSGVLIVSLGRHMRTMRAKTKDSHDPSLEA HIKALRSLVSFLCLYVVSFCAALVSVPLLMLWHNKIGVMI CVGILAACPSIHAAILISGNAKLRRAVETILLWVQNSLKI GADHKADARTPGLC

Known Ligands help

Download SDF file of selected compounds.

3D Homology Model help

No model available yet.

Links and Citations:

M3X5D2

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402