BitterDB

fTas2r9 - Taste receptor type 2 member 9 help

Properties help

  • Cat
  • chrB4:47,404,518-47,405,531
  • 0
  • 37,772 (Da)


  • MPSAVEVIYMVLIAGELTIGIWGNGFIVLVNCTGWLQRRD SSVIDIILVSLAISRICVLCVVSAEGFVLLLSPHAYAQNE TINTLDAFWTLSNHSSVWFTACLSIFYLLKIANISHPVFL WLKLNVTRVVLGLFLASFLTSIIISVFLKEGSWGHVEVNH EENITWEFRVSKAPSAFKLIILNLGALVPFALCLISFVLL LFSLFRHAKQMQLYATGSRDCSTEAHMRAIKAVTIFLLFF IMYYAVFLVVTSSFLIPQGRLVLMFGGIVTVIFPSSHSFI LIMGNSKLREAFLKVLRCVKGFHKRRKPLVPQRILNTGRK KSTKDCLPSPRGLHSFA

Known Ligands help

No ligand has been identified.

3D Homology Model help

No model available yet.

Links and Citations:

M3W1M2

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402