BitterDB

fTas2r4 - Taste receptor type 2 member 4 help

Properties help

  • Cat
  • chrA2:157,888,071-157,888,991
  • 4
  • (Da)


  • MHQILFLSALTVSAILNFVGLVVNLFIVVVNYRTWVQSHR ISSSNRILFSLGVTRFIMLGLFLLNIIYLFTSPHVERSVH LSTFFLLCWMFLESTSLWLVTLLNALYCVKITDFQHSVFL LLKRKLSPKIPRLLLACVLISAFSTLLYVVLTQTSPFPEF LTGSNGTVCDINKSILSLVTSLVLSSFLQFIMNVTSASLL IHSLRRHIQKMQKNATDFWNPQTEALMGAMKLMIYFLILY IPYSLATLLQYLPSVRMDLGATSICMIISTFYPPGHSVLI ILTHPKLKTKAKKILCFNIWWNFSSK

Known Ligands help

3D Homology Model help

No model available yet.

Links and Citations:

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402