BitterDB

fTas2r1 - Taste receptor type 2 member 1 help

Properties help

  • Cat
  • chrA1:234,525,305-234,526,201 ?
  • 0
  • 33,807 (Da)


  • MLDFYLIIHFLLPVIQCLIGVLANGIIVIVNGTELIKQRK MVPLDLLLSCLAISRICLQSFIFYINLVILSLIDFLPLVK NFAVFMFVNETGLWLATWLGVFYCAKISPIAHPLFFWLKR RISKLVPWLIIGSLLFASIPLVFYSKHTWVLSQEVLLRLF SPNATTQIKETSALQIVFLARFSPPFIIFLTSTLLLVFSL GRHTWQMRNTATGTRDGSTGVHVSALLSILSFLVLYLSHY MTAALLSSHIFELRSFMFLFCILVFGSYPSGHSIILISGN RKLKQNAKKFLLHGQCCQ

Known Ligands help

No ligand has been identified.

3D Homology Model help

Click here to download the model PDB file.

Links and Citations:

M3WH93

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402