BitterDB

mTas2r139 - Taste receptor type 2 member 139 help

Properties help

  • Mouse
  • chr6:42,140,936-42,141,895 UCSC
  • 1
  • 36,308 (Da)


  • MAQPSNYWKQDVLPLSILMLTLVATECTIGIIASGIVMAV NAVSWVQKKAISITTRILLLLSVSRIGLQSIMLIEITSSI FNVAFYNSVLYRVSNVSFVFLNYCSLWFAALLSFFHFVKI ANFSYPLFFKLKWRISELMPWLLWLSVFISFSSSMFFSKH KFTVNNNNSLSNNICNFTMKLYVVETNVVNVSFLFISGIL PPLTMFVATATLLIFSLRRHTLNMRNSATGSRNPCIEAHM QAIKETSCFLFLYILNAAALLLSTSNIVDASLFWSIVIRI VLPVYPAGHSVLLIQNNPGLRRTWKHLQSQIHLYLQNRF

Known Ligands help

Download SDF file of selected compounds.

3D Homology Model help

No model available yet.

Links and Citations:

Q7TQA5
t2r39_mouse

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402