BitterDB

mTas2r138 - Taste receptor type 2 member 138 help

Properties help

  • Mouse
  • chr6:40,612,314-40,613,310 UCSC
  • 2
  • 36,966 (Da)


  • MLSLTPVLTVSYEAKISFLFLSAMEFAVGILANAFIVLVN VWDVVKKQPLNNCDIALLCLSITRLFLQGLLLLDAIQLAC FQQMKDPLSHNYQAILTLWMIANQVSLWLAACLSLLYCSK IVRFSHTFPLHVASWVSRRFLQMLLVVLLLSCICTALCLW DFFCRSHSTVTSLLHLNSTEFSLQIAKLNFFYSFIFCNVG SVPPSLAFLVSSGVLVISLGSHMRTMKSQTSSSGDPSLEA HIRAIIFLISFFCFYVVSFCAALISIPLLMLWHNKGGVMI CIGMMAACPSGHAAILISGNAKLRRAIETMLFWFQSRQKV RPVHKVPPRTL

Known Ligands help

Download SDF file of selected compounds.

3D Homology Model help

Click here to download the model PDB file.

Links and Citations:

Q7TQA6
t2r38_mouse

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402