BitterDB

mTas2r129 - Taste receptor type 2 member 129 help

Properties help

  • Mouse
  • chr6:132,951,102-132,952,064 UCSC
  • 0
  • 37,178 (Da)


  • MDGIVQNMFTFIVIVEIIIGWIGNGFIALVNCIHWYKRRK ISALNQILTALAFSRIYLLLTVFTVIAVSTLYTHVLVTRR VVKLINFHLLFSNHFSMWLAACLGLYYFLKIAHFPNSIFV YLKMRINQVVSGTLLMSLGLLFLNTLLINSYIDTKIDDYR EHLLYDFTSNNTASFYRVILVINNCIFTSIPFTLSQSTFL LLIFSLWRHYKKMQQHAQRCRDVLADAHIRVLQTMVTYVL LCAIFFLSLSMQILRSELLKNILYVRFCEIVAAVFPSGHS CVLICRDTNLRGTFLSVLSWLKQRFTSWIPNINCRSSCIF

Known Ligands help

No ligand has been identified.

3D Homology Model help

No model available yet.

Links and Citations:

Q7M709

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402