BitterDB

mTas2r123 - Taste receptor type 2 member 123 help

Properties help

  • Mouse
  • chr6:132,847,142-132,848,143 UCSC
  • 10
  • 3,832 (Da)


  • MFSQKINYSHLFTFSITLYVEIVTGILGHGFIALVNIMDW VKRRRISSVDQILTALALTRFIYVLSMLICILLFMLCPHL PRRSEMLSAMGIFWVVNSHFSIWLTTCLGVFYFLKIANFS NSFFLYLKWRVKKVILIIILASLIFLTLHILSLGIYDQFS IAAYVGNMSYSLTDLTQFSSTFLFSNSSNVFLITNSSHVF LPINSLFMLIPFTVSLVAFLMLIFSLWKHHKKMQVNAKQP RDVSTMAHIKALQTVFSFLLLYAIYLLFLIIGILNLGLME KIVILIFDHISGAVFPISHSFVLILGNSKLRQASLSVLPC LRCQSKDMDTMGL

Known Ligands help

Please scroll down to see the rest of the ligands.

Download SDF file of selected compounds.

3D Homology Model help

No model available yet.

Links and Citations:

P59528

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402