BitterDB

mTas2r121 - Taste receptor type 2 member 121 help

Properties help

  • Mouse
  • chr6:132,700,089-132,701,007 UCSC
  • 16
  • 35,521 (Da)


  • MGSNVYGILTMVMIAEFVFGNMSNGFIVLINCIDWVRKGT LSSIGWILLFLAISRMVLIWEMLITWIKYMKYSFSFVTGT ELRGIMFTWVISNHFSLWLATILSIFYLLKIASFSKPVFL YLKWREKKVLLIVLLGNLIFLMLNILQINKHIEHWMYQYE RNITWSSRVSDFAGFSNLVLLEMIVFSVTPFTVALVSFIL LIFSLWKHLQKMHLNSRGERDPSTKAHVNALRIMVSFLLL YATYFISFFLSLIPMAHKTRLGLMFSITVGLFYPSSHSFI LILGHSNLRQASLWVMTYLKCGQKH

Known Ligands help

3D Homology Model help

Click here to download the model PDB file.

Links and Citations:

Q7M720
t2r13_mouse

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402