BitterDB

mTas2r119 - Taste receptor type 2 member 119 help

Properties help

  • Mouse
  • chr15:32,177,288-32,178,294 UCSC
  • 8
  • 37,735 (Da)


  • MMEGHMLFFLLVVVVQFLTGVLANGLIVVVNAIDLIMWKK MAPLDLLLFCLATSRIILQLCILFAQLGLSCLVRHTLFAD NVTFVYIINELSLWFATWLGVFYCAKIATIPHPLFLWLKM RISRLVPWLILASVVYVTVTTFIHSRETSELPKQIFISFF SKNTTRVRPAHATLLSVFVFGLTLPFLIFTVAVLLLLSSL WNHSRQMRTMVGTREPSRHALVSAMLSILSFLILYLSHDM VAVLICTQGLHFGSRTFAFCLLVIGMYPSLHSIVLILGNP KLKRNAKTFIVHCKCCHCARAWVTSRNPRLSDLPVPATHH SANKTSCSEACIMPS

Known Ligands help

Please scroll down to see the rest of the ligands.

Download SDF file of selected compounds.

3D Homology Model help

Click here to download the model PDB file.

Links and Citations:

Q9JKT2
tr119_mouse

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402