BitterDB

mTas2r118 - Taste receptor type 2 member 118 help

Properties help

  • Mouse
  • chr6:23,969,160-23,970,060 UCSC
  • 0
  • 34,761 (Da)


  • MVPTQVTIFSIIMYVLESLVIIVQSCTTVAVLFREWMHFQ RLSPVETILISLGISHFCLQWTSMLYNFGTYSRPVLLFWK VSVVWEFMNILTFWLTSWLAVLYCVKVSSFTHPIFLWLRM KILKLVLWLILGALIASCLSIIPSVVKYHIQMELVTLDNL PKNNSLILRLQQFEWYFSNPLKMIGFGIPFFVFLASIILL TVSLVQHWVQMKHYSSSNSSLKAQFTVLKSLATFFTFFTS YFLTIVISFIGTVFDKKSWFWVCEAVIYGLVCIHFTSLMM SNPALKKALKLQFWSPEPS

Known Ligands help

No ligand has been identified.

3D Homology Model help

No model available yet.

Links and Citations:

P59529
t2r16_mouse

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402