BitterDB

mTas2r117 - Taste receptor type 2 member 117 help

Properties help

  • Mouse
  • chr6:132,802,817-132,803,975 UCSC
  • 7
  • 38,528 (Da)


  • MKHFWKILSVISQSTLSVILIVELVIGIIGNGFMVLVHCM DWVKKKKMSLVNQILTALSISRIFQLCLLFISLVINFSYT DLTTSSRMIQVMYNAWILANHFSIWIATCLTVLYFLKIAN FSNSFFLYLKWRVEKVVSVTLLVSLLLLILNILLTNLETD MWTNEYQRNISCSFSSHYYAKCHRQVLRLHIIFLSVPVVL SLSTFLLLIFSLWTHHKRMQQHVQGGRDARTTAHFKALQT VIAFFLLYSIFILSVLIQIWKYELLKKNLFVVFCEVVYIA FPTFHSYILIVGDMKLRQACLPLCIIAAEIQTTLCRNFRS LKYFRLCCIF

Known Ligands help

Please scroll down to see the rest of the ligands.

Download SDF file of selected compounds.

3D Homology Model help

Click here to download the model PDB file.

Links and Citations:

Q7M715

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402