BitterDB

mTas2r116 - Taste receptor type 2 member 116 help

Properties help

  • Mouse
  • chr6:132,855,530-132,856,265 UCSC
  • 0
  • 35,095 (Da)


  • MNGVLQVTFIVILSVEFIIGIFGNGFIAVVNIKDLVKGRK ISSVDQILTALAISRIALLWLILVSWWIFVLYPGQWMTDR RVSIMHSIWTTFNQSSLWFATSLSIFYFFKIANFSNPIFL YLKVRLKKVMIGTLIMSLILFCLNIIIMNAPENILITEYN VSMSYSLILNNTQLSMLFPFANTMFGFIPFAVSLVTFVLL VFSLWKHQRKMQHSAHGCRDASTKAHIRALQTLIASLLLY SIFFLSHVMKVWSALLLERTLLLLITQVARTAFPSVHSWV LILGNAKMRKASLYVFLWLRCRHKE

Known Ligands help

No ligand has been identified.

3D Homology Model help

No model available yet.

Links and Citations:

Q7M713

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402