BitterDB

mTas2r114 - Taste receptor type 2 member 114 help

Properties help

  • Mouse
  • chr6:131,689,134-131,690,063 UCSC
  • 7
  • 35,732 (Da)


  • MLSTMEGVLLSVSTSEAVLGIVGNTFIALVNCMDYNRNKK LSNIGFILTGLAISRICLVLILITEAYIKIFYPQLLSPVN IIELISYLWIIICQLNVWFATSLSIFYFLKIANFSHYIFV WLKRRIDLVFFFLIGCLLISWLFSFPVVAKMVKDNKMLYI NTSWQIHMKKSELIINYVFTNGGVFLFFMIMLIVCFLLII SLWRHRRQMESNKLGFRDLNTEVHVRTIKVLLSFIILFIL HFMGITINVICLLIPESNLLFMFGLTTAFIYPGCHSLILI LANSRLKQCSVMILQLLKCCENGKELRDT

Known Ligands help

Please scroll down to see the rest of the ligands.

Download SDF file of selected compounds.

3D Homology Model help

Click here to download the model PDB file.

Links and Citations:

Q7M722

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402