BitterDB

mTas2r108 - Taste receptor type 2 member 108 help

Properties help

  • Mouse
  • chr6:40,493,591-40,494,485 UCSC
  • 8
  • 34,202 (Da)


  • MLWELYVFVFAASVFLNFVGIIANLFIIVIIIKTWVNSRR IASPDRILFSLAITRFLTLGLFLLNSVYIATNTGRSVYFS TFFLLCWKFLDANSLWLVTILNSLYCVKITNFQHPVFLLL KRTISMKTTSLLLACLLISALTTLLYYMLSQISRFPEHII GRNDTSFDLSDGILTLVASLVLNSLLQFMLNVTFASLLIH SLRRHIQKMQRNRTSFWNPQTEAHMGAMRLMICFLVLYIP YSIATLLYLPSYMRKNLRAQAICMIITAAYPPGHSVLLII THHKLKAKAKKIFCFYK

Known Ligands help

Please scroll down to see the rest of the ligands.

Download SDF file of selected compounds.

3D Homology Model help

Click here to download the model PDB file.

Links and Citations:

Q9JKT3
ta2r4_mouse

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402