BitterDB

mTas2r105 - Taste receptor type 2 member 105 help

Properties help

  • Mouse
  • chr6:131,686,561-131,687,463 UCSC
  • 46
  • 34,416 (Da)


  • MLSAAEGILLSIATVEAGLGVLGNTFIALVNCMDWAKNNK LSMTGFLLIGLATSRIFIVWLLTLDAYAKLFYPSKYFSSS LIEIISYIWMTVNHLTVWFATSLSIFYFLKIANFSDCVFL WLKRRTDKAFVFLLGCLLTSWVISFSFVVKVMKDGKVNHR NRTSEMYWEKRQFTINYVFLNIGVISLFMMTLTACFLLIM SLWRHSRQMQSGVSGFRDLNTEAHVKAIKFLISFIILFVL YFIGVSIEIICIFIPENKLLFIFGFTTASIYPCCHSFILI LSNSQLKQAFVKVLQGLKFF

Known Ligands help

3D Homology Model help

Click here to download the model PDB file.

Links and Citations:

Q9JKT4
tr105_mouse

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402