BitterDB

hTAS2R16 - Taste receptor type 2 member 16 help

Properties help

  • Human
  • chr7:122,634,759-122,635,754 UCSC
  • 13
  • 33,986 (Da)


  • MIPIQLTVFFMIIYVLESLTIIVQSSLIVAVLGREWLQVR RLMPVDMILISLGISRFCLQWASMLNNFCSYFNLNYVLCN LTITWEFFNILTFWLNSLLTVFYCIKVSSFTHHIFLWLRW RILRLFPWILLGSLMITCVTIIPSAIGNYIQIQLLTMEHL PRNSTVTDKLENFHQYQFQAHTVALVIPFILFLASTIFLM ASLTKQIQHHSTGHCNPSMKARFTALRSLAVLFIVFTSYF LTILITIIGTLFDKRCWLWVWEAFVYAFILMHSTSLMLSS PTLKRILKGKC

Known Ligands help

3D Homology Model help

Click here to download the model PDB file.

When using this 3D model, please cite us:
Promiscuity and selectivity of bitter molecules and their receptors. Bioorg Med Chem 23 (2015) 4082-4091.
doi: 10.1016/j.bmc.2015.04.025

Protein Diagram help

Receptor snake diagram

When using this 2D protein diagram,please cite us:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper: BitterDB paper

SNPs Table help

ReceptorLocationBW numberResidueMAFdbSNP
TAS2R16EC2N172K0.0883rs846664
TAS2R16IC3R222H0.2708rs860170

Known Mutations Table help

ReceptorLocationBW numberResidueReferences
TAS2R16TM11.38I13doi: 10.1038/s41598-017-07256-y
TAS2R16TM11.39Y14doi: 10.1038/s41598-017-07256-y
TAS2R16TM11.46I21doi: 10.1038/s41598-017-07256-y
TAS2R16TM11.49Q24doi: 10.1038/s41598-017-07256-y
TAS2R16TM22.39V45doi: 10.1038/s41598-017-07256-y
TAS2R16TM22.4D46doi: 10.1038/s41598-017-07256-y
TAS2R16TM22.42I48doi: 10.1038/s41598-017-07256-y
TAS2R16TM22.45S51doi: 10.1038/s41598-017-07256-y
TAS2R16TM22.49S55doi: 10.1038/s41598-017-07256-y
TAS2R16TM22.5R56doi: 10.1038/s41598-017-07256-y
TAS2R16TM22.52C58doi: 10.1038/s41598-017-07256-y
TAS2R16TM22.53L59doi: 10.1038/s41598-017-07256-y
TAS2R16TM22.54Q60doi: 10.1038/s41598-017-07256-y
TAS2R16TM22.55W61doi: 10.1038/s41598-017-07256-y
TAS2R16EC12.58M64doi: 10.1038/s41598-017-07256-y
TAS2R16EC12.71V77doi: 10.1038/s41598-017-07256-y
TAS2R16EC12.73C79doi: 10.1038/s41598-017-07256-y
TAS2R16EC13.28L81doi: 10.1038/s41598-017-07256-y
TAS2R16EC13.29T82doi: 10.1038/s41598-017-07256-y
TAS2R16TM33.3I83doi: 10.1038/s41598-017-07256-y
TAS2R16TM33.32W85doi: 10.1038/s41598-017-07256-y
TAS2R16TM33.33E86doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.3389/fmolb.2017.00063
TAS2R16TM33.35F88doi: 10.1038/s41598-017-07256-y
TAS2R16TM33.36N89doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1038/s41598-017-07256-y doi: 10.3389/fmolb.2017.00063
TAS2R16TM33.37I90doi: 10.1038/s41598-017-07256-y
TAS2R16TM33.4F93doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1038/s41598-017-07256-y doi: 10.3389/fmolb.2017.00063
TAS2R16TM33.41W94doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1038/s41598-017-07256-y
TAS2R16TM33.42L95doi: 10.1038/s41598-017-07256-y
TAS2R16TM33.44S97doi: 10.1038/s41598-017-07256-y
TAS2R16TM33.48V101doi: 10.1038/s41598-017-07256-y
TAS2R16TM33.5Y103doi: 10.1038/s41598-017-07256-y
TAS2R16TM33.51C104doi: 10.1038/s41598-017-07256-y
TAS2R16ICL24.36L118doi: 10.1038/s41598-017-07256-y
TAS2R16ICL24.4I122doi: 10.1038/s41598-017-07256-y
TAS2R16ICL24.42R124doi: 10.1038/s41598-017-07256-y
TAS2R16TM44.47I129doi: 10.1038/s41598-017-07256-y
TAS2R16TM44.52L134doi: 10.1038/s41598-017-07256-y
TAS2R16TM44.61P143doi: 10.1038/s41598-017-07256-y
TAS2R16TM44.62S144doi: 10.1038/s41598-017-07256-y
TAS2R16EC24.66N148doi: 10.1038/s41598-017-07256-y
TAS2R16EC25.34N172doi: 10.1038/s41598-017-07256-y
TAS2R16TM55.39Q177doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.3389/fmolb.2017.00063
TAS2R16TM55.43H181doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.3389/fmolb.2017.00063
TAS2R16TM55.45V183doi: 10.1038/s41598-017-07256-y
TAS2R16TM55.46A184doi: 10.1038/s41598-017-07256-y
TAS2R16TM55.47L185doi: 10.1038/s41598-017-07256-y
TAS2R16TM55.48V186doi: 10.1038/s41598-017-07256-y
TAS2R16TM55.5P188doi: 10.1038/s41598-017-07256-y
TAS2R16TM55.51F189doi: 10.1038/s41598-017-07256-y
TAS2R16TM55.53L191doi: 10.1038/s41598-017-07256-y
TAS2R16TM55.61L199doi: 10.1038/s41598-017-07256-y
TAS2R16TM55.62M200doi: 10.1038/s41598-017-07256-y
TAS2R16TM55.65L203doi: 10.1038/s41598-017-07256-y
TAS2R16TM66.37L226doi: 10.1038/s41598-017-07256-y
TAS2R16TM66.4L229doi: 10.1038/s41598-017-07256-y
TAS2R16TM66.47F236doi: 10.1038/s41598-017-07256-y
TAS2R16TM66.52F240doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1371/journal.pone.0064675 doi: 10.3389/fmolb.2017.00063
TAS2R16TM66.54I243doi: 10.1021/acs.jctc.5b00472 doi: 10.1016/bs.mcb.2015.10.005 doi: 10.1038/s41598-017-07256-y doi: 10.3389/fmolb.2017.00063
TAS2R16TM66.55L244doi: 10.1038/s41598-017-07256-y
TAS2R16TM66.56I245doi: 10.1038/s41598-017-07256-y
TAS2R16TM77.34W257doi: 10.1038/s41598-017-07256-y
TAS2R16TM77.35L258doi: 10.1038/s41598-017-07256-y
TAS2R16TM77.38W261doi: 10.1038/s41598-017-07256-y
TAS2R16TM77.39E262doi: 10.1038/s41598-017-07256-y
TAS2R16TM77.42V265doi: 10.1038/s41598-017-07256-y
TAS2R16TM77.43Y266doi: 10.1038/s41598-017-07256-y
TAS2R16TM77.48M271doi: 10.1038/s41598-017-07256-y
TAS2R16TM77.5S273doi: 10.1038/s41598-017-07256-y
TAS2R16TM77.52S275doi: 10.1038/s41598-017-07256-y
TAS2R16TM77.53L276doi: 10.1038/s41598-017-07256-y
TAS2R16C-Term7.61K284doi: 10.1038/s41598-017-07256-y

Links and Citations:

Q9NYV7
t2r16_human
TAS2R16
ENSG00000128519-TAS2R16

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402