BitterDB

hTAS2R16 - Taste receptor type 2 member 16 help

Properties help

  • Human
  • chr7:122,634,759-122,635,754 UCSC
  • 8
  • 33,986 (Da)


  • MIPIQLTVFFMIIYVLESLTIIVQSSLIVAVLGREWLQVR RLMPVDMILISLGISRFCLQWASMLNNFCSYFNLNYVLCN LTITWEFFNILTFWLNSLLTVFYCIKVSSFTHHIFLWLRW RILRLFPWILLGSLMITCVTIIPSAIGNYIQIQLLTMEHL PRNSTVTDKLENFHQYQFQAHTVALVIPFILFLASTIFLM ASLTKQIQHHSTGHCNPSMKARFTALRSLAVLFIVFTSYF LTILITIIGTLFDKRCWLWVWEAFVYAFILMHSTSLMLSS PTLKRILKGKC

Known Ligands help

Please scroll down to see the rest of the ligands.

Protein Diagram help

Receptor snake diagram

When using this 2D protein diagram,please cite us:
Ayana Wiener; Marina Shudler; Anat Levit; Masha Y. Niv. BitterDB: a database of bitter compounds. Nucleic Acids Res 2012, 40(Database issue):D413-419.
Click here to view the paper: BitterDB paper

Known Mutations Table help

Residue Location Ballesteros-Weinstein: Mutation Experimental data Reference
E86 TM3 3.33 E86D Reduced response to salicin, large reduction in its response to arbutin and phenyl-β-D-glucopyranoside [1]
E86Q Reduced response to salicin
N89 TM3 3.36 N89Q Lost receptor responsivenes to salicin [1]
N89D
N89V
N89L
N89A
F93 TM3 3.40 F93T Greatly reduced response to salicin [1]
F93Y
F93A
W94 TM3 3.41 W94F Small difference in receptor responsiveness to Salicin [1]
W94I Significantly decrease in receptor responsiveness to salicin
Q177 TM5 5.39 Q177N Not significantly affected the receptor activity by salicin [1]
Q177E
Q177A
H181 TM5 5.43 H181T small decrease in receptor responsiveness to salicin Interaction with ligands
H181L Significantly decrease in receptor responsiveness to salicin
F240 TM6 6.51 F240Y Reduced response to salicin [1]
F240L Greatly reduced response to salicin
F240W Reduced response to salicin
I243 TM6 6.54 I243L Mild reduced response to salicin [1]
I243V Mild reduced response to salicin
I243A Greatly reduced response to salicin

[1] Sakurai, T. et al. (2010) Characterization of the beta-D-glucopyranoside binding site of the human bitter taste receptor hTAS2R16,, The Journal of biological chemistry, 285, 28373-8.

Links:

Q9NYV7
TAS2R16