BitterDB

ggTAS2R7 - Taste receptor type 2 member 107 help

Properties help

  • Chicken
  • chr3:109,476,673-109,477,638
  • 17
  • 36,948 (Da)


  • MAEQHNTTSSSSAFVVIFAFQALAGMGINAFIVAASCMAW FKKKG

Known Ligands help

Please scroll down to see the rest of the ligands.

Protein Diagram help

Known Mutations Table help

No mutations were reported yet.

Links:

Q2AB81
TAS2R7