BitterDB

ggTAS2R2 - Taste receptor type 2 member 102 help

Properties help

  • Chicken
  • chr1:190,288,727-190,289,720
  • 8
  • 35,209 (Da)


  • MLPPVLIVSMCIVAIEVVVGFMGNGFITAVNSINWIKSKR ISAAD

Known Ligands help

Please scroll down to see the rest of the ligands.

Protein Diagram help

Known Mutations Table help

No mutations were reported yet.

Links:

Q2AB82
TAS2R2