BitterDB

ggTas2r2 - Taste receptor type 2 member 2 help

Properties help

  • Chicken
  • chr1:190,288,727-190,289,720
  • 9
  • 35,209 (Da)


  • MLPPVLIVSMCIVAIEVVVGFMGNGFITAVNSINWIKSKR ISAADMILIFLSTSRFILQV TVMMYIHSLYFTDVFKLAS VYKTFGAIWMFVNHASLWFSTWLYVLYCVKIINVTQWLLL Q IKHRITAMIPWLLLGSLLISSVTSFPLLWITPNTYLCR STGNCGDNSTAHISGWDSSHLY LLLLYFTGCFFPLVLSM ITSGLLINSLWKHTKKMQCYVDSFRDPLIDVHLIAIKSII SFL ILYISSFVAQILLTLSTSQSKDFVKVAVSLVVTGAY PSIHSIILIIVNSKLKLALRMLCQ HFMCHLENVNL

Known Ligands help

Please scroll down to see the rest of the ligands.

Download SDF file of selected compounds.

3D Homology Model help

Click here to download the model PDB file.

When using this 3D model, please cite us:
Ligand binding modes from low resolution GPCR models and mutagenesis: chicken bitter taste receptor as a test-case. Sci Rep 7 (2017) 8223.doi: 10.1038/s41598-017-08344-9

Links and Citations:

Q2AB82

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402