BitterDB

ggTas2r1 - Taste receptor type 2 member 1 help

Properties help

  • Chicken
  • chr1:77,295,128-77,296,180
  • 14
  • 35,281 (Da)


  • MSSLFSSFCLVIAIFESVVGLLGNGTIVAVSSTSCIRSKI LSSYDVIVIFLSLSRFFLQL WMILDFLLIFFCQPSYYEE NLFVTFKTVFIFLNSYSFWFAAWLSVFYCVKVASFTQSFL S WLKQRIASLIPWMLITSSLFSFATSLPFFWDSYNAHSN FTTPLTMTNSSKRITTRKTNLI FLILLCNVGIALPSIML VFSSILLIRSLWRHTRQMQNNATGFRDPSLEALIGAIKTV FSF LLLYITNFIALILILSDTFVPLSTEEAICVVVVAAC PAGQSMVLIWSNPRFRELLSSILH YVNSCVRARCS

Known Ligands help

3D Homology Model help

Click here to download the model PDB file.

When using this 3D model, please cite us:
Ligand binding modes from low resolution GPCR models and mutagenesis: chicken bitter taste receptor as a test-case. Sci Rep 7 (2017) 8223.doi: 10.1038/s41598-017-08344-9

Links and Citations:

Q2AB83

3D Visualizer: NGL: A WebGL Protein Viewer
AS Rose and PW Hildebrand. NGL Viewer: a web application for molecular visualization. Nucl Acids Res (1 July 2015) 43 (W1): W576-W579. doi: 10.1093/nar/gkv402